KEGG   Burkholderia pseudomultivorans: WS57_07790
Entry
WS57_07790        CDS       T04870                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00440  Phosphonate and phosphinate metabolism
bpsl00998  Biosynthesis of various secondary metabolites - part 2
bpsl01100  Metabolic pathways
bpsl01110  Biosynthesis of secondary metabolites
bpsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    WS57_07790
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    WS57_07790
Enzymes [BR:bpsl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     WS57_07790
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: AOI88707
LinkDB
Position
2:1841788..1843476
AA seq 562 aa
MNAREPNFTESRSARLRRMLVSDELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQSVAREIHENQTLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHASTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTEPTNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNV
RGGGVERLKAMLATLQARDDFDTLDIPALLNELIAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPMSEPGAGNGSAQ
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcgacgagctcgaattcctgatggaagcgcacaacggcctgtccgcacgcatcgtc
cgcgaagccggcttcaagggcatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaggcgagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgaccccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgcccaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcgtcggcgatgcagtccgtcgcacgcgaa
atccacgagaaccagacgctgatcaacgtcgaggatcgcgtcgcgtcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgcggcgatcgtgctcgccgcgagccgcggcaagggcctggaggcc
gtcaccgaggacaagccgaaggtgatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gcggatgcgatcgacacgtcgggcatcaagctcgtcgtcaacgaacgccatgcatcgacc
ggcgaactcgcatcgctcgcctgcgcggccgagcgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggccgaa
ttcagcgtcgtcgtcgattcgtcgctgaccgagccgaccaaccagagcgtgcgcgatttc
gcgctgtgctcggcggccgacgatcgcggcctgttcggccagaagacgtatctgcagcgc
gtatcgagcgacgtcgccgcgggcacgccgcacggccgctggatcggcctgctgaacgtg
cgcggcggcggcgtcgaacgcctgaaggcgatgctcgcgacgctgcaggcgcgcgacgat
ttcgacacgctcgacatccctgcgctgctcaacgaactgatcgccgccggcgagaagatc
gaggtgcagtacgtgcacggacactggcgcggcgtcaacgatctcgaagacttccgccgc
gcgggcgacttcgcgcacggccagacgccgatgtccgagccgggtgccggcaacgggagc
gcacaatga

DBGET integrated database retrieval system