KEGG   Burkholderia pseudomultivorans: WS57_10170Help
Entry
WS57_10170        CDS       T04870                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WS57_10170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpsl02000]
    WS57_10170
Enzymes [BR:bpsl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     WS57_10170
Transporters [BR:bpsl02000]
 Other Transporters
  Pores ion channels [TC:1]
   WS57_10170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 FbpA
Motif
Other DBs
NCBI-ProteinID: AOI89137
LinkDB All DBs
Position
2:complement(2373575..2374237)
Genome map
AA seq 220 aa AA seqDB search
MESTGQTTLTISSRNYSSWSMRGWLLAKLSGLAFETVSVPIDAASRAELLLLSPSILVPC
LTHDGNQVWDTLAIAEYLNEIRPQARLLPADRHARAHCRSICGEMHSGFSALRSALPMNL
RAHFPGFRIWSRAQHDIERIVTIWRECLAAYGGPWLFGAEIGIADAMYAPVVTRFLTYDV
KLEPDIADYCMRVLAQPFVAEWIEGAKAEHEDIDELDMEF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaccggacagacgacgctgacgatcagcagccgcaactactcgtcgtggtcg
atgcgaggctggctgctcgcgaagctgagcgggctcgcgttcgagacggtgagcgtgccg
atcgatgcggcgtcgcgcgccgagctgctgctgctgtcgccgtcgattctcgtaccgtgc
ctcacgcacgacggcaaccaggtgtgggacacgctcgcgatcgccgaatacctgaacgag
atccggccgcaggcgcgactgctgcccgcggatcggcatgcgcgcgcgcattgccgttcg
atctgcggcgaaatgcattcgggtttcagtgcgctgcgctccgcgttgccgatgaacctg
cgcgcgcattttcccggcttccggatctggtcgcgcgcgcagcacgacatcgagcggatc
gtgacgatctggcgcgagtgtctcgccgcgtacggcggcccctggctgttcggcgcggag
atcggcatcgccgatgcgatgtatgcgccggtcgtcacgcgcttcctgacctacgacgtg
aagctcgaaccggacatcgccgactactgcatgcgcgtgctcgcgcagccgttcgtcgcc
gaatggatcgaaggcgcgaaggccgagcacgaggatatcgacgagctcgacatggagttc
tga

DBGET integrated database retrieval system