KEGG   Burkholderia pseudomultivorans: WS57_12725Help
Entry
WS57_12725        CDS       T04870                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
bpsl  Burkholderia pseudomultivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC HTH_31
Motif
Other DBs
NCBI-ProteinID: AOI89577
LinkDB All DBs
Position
2:complement(2939230..2940210)
Genome map
AA seq 326 aa AA seqDB search
MTNSTVLSCTHGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEVTKTDLALPGLG
IADIRGQDHVIERSPALVRQLPKEALFACQIVSGRAYFIQHDRCLLAEAGDIVVYDTRVP
YLFGFLTPMRQLLIDIPIAMIDRRLEAELALLPLKISPRPGAGEMLGTTLRASVERFMKT
PVEGDAARFSECTRTLVAELIDAEVNGVRASRTSLSYLLTAKQYIATHLGEPELGPQAVA
DAVGLSLRHLSRLFAAEGESVTQHIWSERLLHAYRELTDARLRKTSVGEIAFRWGFSSQA
HFSRAIRDRYGASPMALRDAARTTDR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttctttcatgcacgcacggctcgaccgccgacgtgccggcgcgc
gaccggatggcgtactgggatgcgttcaacgcggcgacgctggtcggcctgcgctgttcg
tcgctgtcgccggcggggctcgaggtcacgaagaccgacctggcgctgccgggcctcggg
atcgccgacattcgcgggcaggaccatgtgatcgagcgcagtccggcgctcgtgcgccag
ttgccgaaggaagcgctgttcgcgtgccagatcgtcagcggacgcgcgtatttcatccag
cacgaccgctgcctgctggcggaagccggcgacatcgtcgtctacgacacgcgcgtcccc
tatcttttcggattcctgacgccgatgcggcagctgttgatcgacatcccgatcgcgatg
atcgaccgccggctcgaagcggaactggcgttgctgccgctgaagatctcgccgcggccc
ggtgcgggcgagatgctcggcaccacgctgcgcgcgagtgtcgagcgcttcatgaagacg
cccgtcgagggcgacgcggcgcgcttctccgagtgcacgcgcacgctggtcgcggaactg
atcgacgccgaggtgaacggcgtgcgcgcctcgcgcacgtcgctgtcgtatctgctgacc
gcgaagcagtacatcgcgacccatctcggcgagccggaactcgggccgcaggccgtcgcc
gatgcggtcgggctgtcgctgcgccacctgagccggctgtttgccgccgagggcgagtcg
gtcacgcagcacatctggtcggaacggctgctgcatgcttaccgcgagctgacggatgcg
cgcctgcgcaagaccagcgtcggcgagatcgcgttccgctggggattttcgagccaggcg
catttcagccgcgcgattcgcgaccggtatggcgcgtcgccgatggcgctgcgcgacgcg
gcgcgcacgaccgaccgctga

DBGET integrated database retrieval system