KEGG   Burkholderia pseudomultivorans: WS57_12730Help
Entry
WS57_12730        CDS       T04870                                 

Definition
(GenBank) 2,4-dihydroxyacetophenone dioxygenase
Organism
bpsl  Burkholderia pseudomultivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AOI89578
UniProt: A0A132F2E6
LinkDB All DBs
Position
2:2940387..2940920
Genome map
AA seq 177 aa AA seqDB search
MVDQAVTEFWQNIAPIANPFKPDALPEVYIANAVTEDERYYVPFTETVSSRPLWISPTQN
KWCDILMAKQAGLVNRHYHPHEVFAYTISGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDEAGNPDGYFDVHSYIAMCKAHYEKVGLGAQAVEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaccaagccgtcaccgaattctggcaaaacatcgcgccgattgccaatccgttc
aagcccgatgcgctgccggaagtctacatcgcgaatgcggtcaccgaggacgagcgatac
tacgttccgttcaccgaaacggtttcgtcgcggccgctgtggatctcgccgacgcagaac
aaatggtgcgacatcctgatggcgaagcaggcggggctcgtgaaccgtcactaccacccg
cacgaagtattcgcgtacacgatctccgggaaatggggctacctcgagcacgagtggacc
gcgacgcgcggcgacttcgtgtacgagacgccgggcgaaggccatacgctcgtcgcgttc
gatcacccggagccgatgcgcgcgttcttcatcgtcaaggggccgctgatctggctcgac
gaggccggcaatcccgacggctacttcgacgtgcattcgtacatcgcgatgtgcaaggcc
cactacgagaaagtgggcctcggtgcacaggcggtcgagaaactgttccgttga

DBGET integrated database retrieval system