KEGG   Burkholderia pseudomultivorans: WS57_12745Help
Entry
WS57_12745        CDS       T04870                                 

Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
bpsl  Burkholderia pseudomultivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR Glyco_transf_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AOI89581
LinkDB All DBs
Position
2:2943344..2944066
Genome map
AA seq 240 aa AA seqDB search
MSQPSVFEGKSVVVTGGTSGIGARTALRFAQAGASVVTLGLDAAGPHAPVHDAIRNVELD
VTDSDALTHTIAALPRLDVLVNGVGISRHADEYLMDQFERVLNVNLTSVMRASDAARPAL
SVNGGSIVNIASMYTYFGSKDRPAYSASKGGVAQLTRSLAQAWADRGIRVNAVAPGWIDT
PLSSGLMADAQASRRILDRTPLGRWGTTDEVAEVILFLCSPGASFVTGAIVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgtcggtgtttgaaggcaagagcgtcgtcgtgacgggcggcacgtcgggc
atcggcgcgcgcaccgcgctgcgtttcgcgcaggcgggcgcgtcggtcgtcacgctcggg
ctcgacgccgccggcccgcatgcgcccgtgcacgacgccatccgcaacgtcgagctggac
gtgaccgacagcgatgcgctgacgcacacgatcgccgcactgccgcgtctcgacgtgctc
gtcaacggcgtcggcatcagccggcacgcggacgaatacctgatggaccagttcgaacgc
gtgctgaacgtgaacctgacgtcggtgatgcgtgcatccgatgccgcacgacccgcgctg
tcggtcaacggcggctcgatcgtcaacatcgcgtcgatgtacacgtacttcggcagcaag
gaccggcccgcgtacagcgcgagcaagggcggcgtcgcgcagctcacgcgctcgctcgcg
caggcgtgggccgatcgcggcatccgcgtcaacgcggtcgcgcccggctggatcgacacg
ccgctcagcagcggactgatggccgacgcgcaggcgtcgcgccggatcctcgatcgcacg
ccgctcgggcgctggggcacgaccgacgaagtcgcggaagtcatcctgttcctgtgctcg
cccggcgcatcgttcgtcaccggcgcgatcgtgccggtcgacggcggctattcgacggtc
tag

DBGET integrated database retrieval system