KEGG   Burkholderia pseudomultivorans: WS57_16830Help
Entry
WS57_16830        CDS       T04870                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
bpsl  Burkholderia pseudomultivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1694
Motif
Other DBs
NCBI-ProteinID: AOI93812
LinkDB All DBs
Position
1:942084..943544
Genome map
AA seq 486 aa AA seqDB search
MTKRTIDLKHPRAFYIGGQWVEPSTAETFDVLDCSTEEVVATVAKAASADMQRAIAAARD
AFDNGPWPRMTPQERAVYLGKFAERLEALNDAFARIWSIETGIVYKVAQPRIGLFISGAF
RQYAEMASTFPFIEEHRSVTGNLGYRVYEPVGVVGEIIPWNGPAGLMAYKTAPALLAGCT
LVIKSSPEAPCSAYLFAEICEEIGLPPGVVNVVTADRDVSEELVRHPGVDKITFTGSTSA
GRRIASIAGDRIARVTLELGGKSPAVVLDDYDIETAANVLGTSYFGYNTGQICHSLTRVI
VPRAKHDTMVEALSNIAARIVVGDPFAPDTTSGPLASARQRETVERYVAKGIAEGATLAA
GGKRPAALPRGFFFEPTVFGNVDNRSTIAQEEIFGPVLSVIPADDEASAIRIANDTPFGL
NAAVFTNDSDRALHAARQIRSGTVSHNGPRTDFSIGFGGFKQSGIGREGGVEGLTAFMES
KTIVMA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagagaacgatcgacctcaagcatcctcgagcgttctatatcggcgggcaatgg
gtggaaccgtccaccgccgaaacgttcgatgtgctcgactgttcgacggaagaagtcgtg
gcgaccgtcgcgaaagccgcgtccgcggacatgcagcgcgccatcgcggcagcgcgcgac
gcgttcgacaatggcccgtggccgcggatgacgccgcaggagcgcgcggtctatctcggc
aagttcgcggaacgtctcgaagcgctgaacgacgcgttcgcacgcatctggtcgatcgag
accggaatcgtctataaggtcgcgcaaccgcgtatcgggctgttcatcagcggcgcattc
cgccagtacgcggagatggcatcgacctttccgttcatcgaggagcaccggtcggtgacc
ggcaacctcggctatcgcgtctacgagccggtcggcgtcgtcggcgaaatcattccgtgg
aacggcccggccgggttgatggcgtacaagaccgcccctgcgctgctcgccggctgcacg
ctggtgatcaagtcgtcgcccgaagcgccctgctctgcttacctgttcgccgagatatgc
gaagaaatcggtttgccgcccggcgtggtcaatgtcgtgacggccgatcgcgacgtgtcc
gaggaactggtccgccaccccggcgtcgacaagatcacattcacgggatccacctctgcg
ggccgccggattgcttcgatcgccggcgaccggatcgcgcgcgtcacgctcgagctcggc
ggaaaatcgcccgccgtcgtgcttgacgactatgacatcgagactgcggcaaacgtgctc
ggcacctcctatttcggctacaacaccgggcagatctgccacagtctaacgcgcgtgatc
gtcccgcgtgcgaagcacgacacgatggtcgaggcgctgtcgaacatcgccgcacggatc
gtggtcggcgatccgttcgcgccggacacgacctccggcccgctcgcgagcgcccgccag
cgtgagaccgtcgagcgctacgtcgcgaagggcatcgccgaaggggccacgcttgccgcc
ggcggcaagcggccggccgcgctgccgcgcggcttcttcttcgagccgacggtgttcggc
aatgtcgacaatcgctcgaccatcgcgcaggaagagatcttcgggccggtgttgagcgtc
attccggccgacgacgaggcgagcgcgatccggatcgcgaacgacacaccgttcggcctg
aatgccgcggtcttcacgaacgacagtgaccgcgcgctgcacgcggcgcggcagatccgt
tcgggcacggtcagccataatggaccgcgcaccgatttctcgatcggcttcggcggcttc
aagcagtctggcattggccgcgaaggcggcgtcgaaggcttgaccgcgttcatggaatcg
aaaaccatcgtcatggcttga

DBGET integrated database retrieval system