KEGG   Burkholderia pseudomultivorans: WS57_20500Help
Entry
WS57_20500        CDS       T04870                                 

Definition
(GenBank) ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
bpsl  Burkholderia pseudomultivorans
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpsl03016]
    WS57_20500
Enzymes [BR:bpsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     WS57_20500
Transfer RNA biogenesis [BR:bpsl03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    WS57_20500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: AOI91173
UniProt: A0A132F6J9
LinkDB All DBs
Position
1:1767141..1769222
Genome map
AA seq 693 aa AA seqDB search
MNVFFEESGSFKAGSVLSRQGDAFQVELPGGRRAKVRAKDVLIEFEKPAASELMQEADAA
AQQIDLDFLWECAPADEFAYTALAEEYFGATYGPVERAALVLRLHGSPVYFRRKGRGQYQ
RAPEEQLKMALASLERKRQQALVQAQYEEELKAGKLPEAFAGKVLGLLTRPDKNAIEYKA
MEAAAGARGVSPARLMLDCGGIESPRALHEARFLAEFFPHGTGFPPVTVGPLPDDLPRAD
VEAFSIDDITTTEIDDAFSVEHLSDGRVRVGVHIAAPALGIVRGDAVDAIARARLSTVYM
PGDKITMLPDDVVDVFTLKEGDYRPALSLYIIVNRDTQEIVANETRAELVYVKNNLRHNT
LDELVTEETLAAGTGDYPHKDDIAVLWPLAQALFEKRQQARAGYGLKREVQRNTDYNFYV
EGEHVTITPRRRGSPLDLIVSELAILANSTWGAFLHDHTVPGIYRSQRGFGTPGPKRTRM
QTTAAPHEGLGVPQYAWSTSPLRRYVDLVNQWQLLACVQHGVTAKLAAPFKPKDADLYAV
VQGFDDTYSAYADYQRRMEYFWCLRWLAQEQKKQVVASVVKGDLVRLEEIPLLLHVPGLG
VHARGTRVLLDVMSLDELTIEASVRLLNVLDAPTVTSGDAADDEEEAEGGDDTLIDAPDE
SAQAEAEALAESDDASAGEGGDAANGNPQERAS
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgttttcttcgaggaatcgggcagtttcaaggcgggcagcgtgctgtcgcgccag
ggcgacgcgtttcaggtcgagttgcccggcgggcggcgcgcgaaggtgcgcgcgaaggac
gtgctgatcgaattcgagaagccggccgcgagcgagctgatgcaggaggccgatgcggcc
gcgcagcagatcgatctggatttcctgtgggaatgcgcgccggccgacgaattcgcgtac
acggcgctggccgaagagtatttcggcgcgacctacggcccggtcgagcgcgcggcgctc
gtgctgcggctgcacggctcgcccgtctacttccgccgcaaggggcgcggccagtaccag
cgcgcgccggaggaacagctgaagatggcgctcgcgtcgctcgagcgcaagcgccagcag
gcgctggtgcaggcgcagtacgaggaagaactgaaggccggcaagctgccggaggcgttc
gcgggcaaggtgctcgggctgctgacgcgcccggacaagaacgcgatcgaatacaaggcg
atggaagcggcggccggcgcgcgcggcgtgtcgccggcgcggctgatgctcgactgcggc
ggcatcgagtcgccgcgcgcgctgcacgaggcgcgctttctcgccgaattcttcccgcac
ggcaccggctttccgcccgtcaccgtcggcccgctgccggacgacctgccgcgcgcggac
gtcgaggcgttctcgatcgacgacatcacgaccaccgaaatcgacgatgcgttctcggtc
gagcacctgtccgacggtcgcgtgcgcgtcggcgtgcacatcgcggcgccggcgctcggc
atcgtgcgcggcgacgcggtcgacgcgatcgcgcgcgcgcgcctgtcgaccgtctacatg
ccgggcgacaagatcacgatgctgccggacgacgtcgtcgacgtgttcacgctgaaggag
ggcgactatcgcccggcgctgtcgctgtacatcatcgtcaaccgcgacacgcaggagatc
gtcgcgaacgagacgcgcgccgagctcgtctacgtgaagaacaacctgcgccacaacacg
ctcgacgagctcgtcaccgaggagacgctcgcggccggcaccggcgactatccgcacaag
gacgacatcgcggtgctgtggccgctcgcgcaggcgctgttcgagaagcgccagcaggcg
cgggcgggctacgggctcaagcgcgaggtgcagcgcaacaccgactacaacttctacgtc
gaaggcgagcacgtgacgatcacgccgcgccgtcgcggctcgccgctcgacctgatcgtg
tcggagctcgcgatcctcgcgaactcgacctggggcgcgttcctgcacgatcacacggtg
ccgggcatctatcgttcgcagcgcggtttcggcacgccgggcccgaagcgcacgcggatg
cagacgacggccgcgccgcacgaaggcctcggcgtgccgcagtatgcgtggagcacgtcg
ccgctgcgccgctacgtcgacctcgtgaaccagtggcagctgctcgcgtgcgtgcagcac
ggcgtcaccgcgaagctggccgcgccgttcaagccgaaggatgcggacctgtacgcggtc
gtgcagggcttcgacgacacgtattccgcctacgccgactatcagcgccggatggaatac
ttctggtgcctgcgctggctcgcgcaggagcagaagaagcaggtcgtcgcgagcgtcgtg
aagggcgatctcgtgcgcctcgaggaaattccgctgctgctgcacgtgccggggctcggc
gtgcatgcgcgcggcacgcgcgtgctgctcgacgtgatgtcgctcgacgagctgacgatc
gaggcgtcggtgcggctgctgaacgtgctcgatgcgccgaccgtgacgagcggcgacgcg
gccgacgacgaagaggaagccgaaggcggcgacgacacgctgatcgacgcgccggacgag
tcggcgcaggccgaggccgaagcgctggccgaatcggacgatgcgtcggccggcgagggc
ggcgacgccgcgaacggcaacccgcaggagcgcgcatcatga

DBGET integrated database retrieval system