KEGG   Burkholderia pseudomallei MSHR511: BBQ_1421Help
Entry
BBQ_1421          CDS       T03012                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00010  Glycolysis / Gluconeogenesis
bpsm00053  Ascorbate and aldarate metabolism
bpsm00071  Fatty acid degradation
bpsm00280  Valine, leucine and isoleucine degradation
bpsm00310  Lysine degradation
bpsm00330  Arginine and proline metabolism
bpsm00340  Histidine metabolism
bpsm00380  Tryptophan metabolism
bpsm00410  beta-Alanine metabolism
bpsm00561  Glycerolipid metabolism
bpsm00620  Pyruvate metabolism
bpsm00625  Chloroalkane and chloroalkene degradation
bpsm00903  Limonene and pinene degradation
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
bpsm01120  Microbial metabolism in diverse environments
bpsm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBQ_1421
   00053 Ascorbate and aldarate metabolism
    BBQ_1421
   00620 Pyruvate metabolism
    BBQ_1421
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBQ_1421
   00561 Glycerolipid metabolism
    BBQ_1421
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBQ_1421
   00310 Lysine degradation
    BBQ_1421
   00330 Arginine and proline metabolism
    BBQ_1421
   00340 Histidine metabolism
    BBQ_1421
   00380 Tryptophan metabolism
    BBQ_1421
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBQ_1421
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBQ_1421
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBQ_1421
Enzymes [BR:bpsm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BBQ_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHG34699
LinkDB All DBs
Position
1:1572968..1574404
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWRPSTGKGMIDVIDSGTEAVIGRVPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLHKITENLKARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEVAPLNAF
ILAEAIHDAGLPAGVFNLVCGYGPVVGEALASDADVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARDLAK
AAAQAYVAGDPRDDATRLGALASSVQQKRVQDYIRRGIDEGAELVTGGLGMPEGITRGFF
VKPTVFGRVKPDATIAQEEIFGPVLSILTYRDEDDAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLDEYLEYKSMQLRPHKRA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctacatcggcggtgcatggcgcccgagcacgggcaagggc
atgatcgacgtgatcgactccggcaccgaggccgtgatcggccgcgtccccgaaggcacc
gccgaagacgcgaaagcggccgtcgcggccgcgcgcgcggcgttcgacggctgggccgcg
acgccgcccgccgagcgcgcccgctatctgcacaagatcaccgagaacctgaaggcgcgc
agcgaggagctcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggcgggccgatctacaactggggcgcgtatgcgaaactcgccgagacc
ttcgcgttcgaggagcaggtgggcaattcgctcgtcgtgcgcgagcctgtcggcgtcgtc
gcggcgatcacgccctggaactatccgctcaaccagatcacgctgaaggtcgcggccgcg
ctcgcggcgggctgcacggtcgcgctgaagccgtccgaggtcgcaccgctcaatgcgttc
atcctcgccgaggcgattcacgacgcggggctgcccgccggcgtgttcaatctcgtgtgc
ggctacgggcccgtcgtcggcgaggcgctcgcgagcgacgccgatgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgaactgggcggcaaatcggcgtcggtgattctcgacgacgccgatttc
gcggccgcggtgaagggcacggtgtccgcgtgctatctgaacgccgggcagacgtgttcc
gcgcatacgcgcatgctcgtgcccgaatcgcgctacgaggaagcgcgcgacctcgcgaag
gccgccgcgcaagcctatgtcgcgggcgatccgcgcgacgacgcgacgcggctcggcgcg
ctcgcgtcgtcggtccagcaaaagcgcgtgcaggattacatccggcgcggcatcgacgaa
ggcgcggagctcgtcacgggcggcctcggcatgccggagggcatcacgcgcggcttcttc
gtgaagccgaccgtgttcgggcgcgtgaagcccgacgcgacgatcgcgcaggaggagatc
ttcggcccggtgctgtcgattctcacgtatcgcgacgaggatgacgcggtgcgcatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggcgggcagcgacgagcgcgcgatg
cgcgtcgcgcgccgcatccgcacggggcaggtcgatatcaacggcggggcatggaacatg
gccgcgccgttcggcggtttcaaacagtcgggcatcggccgcgagaacggcgtgtacggc
ctcgacgaatatctcgaatacaaatcgatgcaattgcgcccgcacaagcgcgcgtga

DBGET integrated database retrieval system