KEGG   Burkholderia pseudomallei MSHR511: BBQ_2337Help
Entry
BBQ_2337          CDS       T03012                                 

Definition
(GenBank) hypothetical protein
Organism
bpsm  Burkholderia pseudomallei MSHR511
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase DUF1513
Motif
Other DBs
NCBI-ProteinID: AHG34042
LinkDB All DBs
Position
1:complement(2686253..2687428)
Genome map
AA seq 391 aa AA seqDB search
MKGFALALPLFGNPAFAQDASAGPAGGVYNLLVGTYTGSGSDGIYVYRFDTDSGRVSPVS
SAKAENPSYLVASRDGRHVYAVNELPGDAGPASVRGGVSAFDFDAKTGALKFVNRVSAQG
NDPCYLSLSPDGRYLVVANYSVASDPGGSFSVFPVEATGALGAAVLNVHHEGTGPVKGRQ
DGAHVHSTVFSPDGKYLFVQDLGADKLYSYRYTPDGSRGLIGPTESRYTLAKAGSGPRHL
VFGANGRFAYVTNELNASVDVYRYDDGRLVHVETVPMTAPGFAGKVGGGALHLSPDGRFL
YATNRGDANDIVIYAVNAADGKLTLVGRQSSLGKTPREFAIDPSGKWLIVGNQDSDSVFV
FRRDIASGRLEPNPARIRIDKPVDFKFVPVQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttttgcgctcgcgctgccgcttttcggcaatcccgccttcgcgcaggacgca
agcgccggccccgcgggcggcgtgtacaacctgctcgtcggcacctacacgggctcgggc
agcgacggcatctacgtgtatcgcttcgataccgactcgggccgggtgagccccgtgtcg
tcggcgaaggccgagaacccgtcgtacctcgtcgcgagccgcgacggccgccacgtgtat
gcggtcaacgaactgccgggtgacgcgggcccggcgagcgtgcgcggcggcgtcagcgcg
ttcgatttcgacgcgaagacgggcgcgctcaagttcgtcaaccgcgtatcggcgcaaggg
aacgatccgtgttacctgagcctgtcgccggacgggcggtatctcgtcgtggcgaattac
tcggtcgcgtccgatccgggcggcagcttctcggtgttcccggtcgaggcgacgggcgcg
ctcggcgccgcggtgctgaacgtgcatcacgagggcacgggcccggtgaaggggcggcag
gacggcgcgcacgtccattcgaccgtgttctcgccggacggcaagtacctgttcgtgcag
gatctcggcgcggacaagctctattcgtaccgctacacgccggacggcagccgcggcctc
atcggcccgaccgagtcgcgctacacgctcgcgaaggcgggctcgggcccgcgccatctg
gtgttcggcgcaaacgggcggttcgcgtacgtgaccaacgagctgaacgcgtcggtcgac
gtgtatcgctacgacgacggccggctcgtgcacgtcgagaccgtgccgatgacggcgccg
ggcttcgcgggcaaggtgggcggcggcgcgctgcatctgtcgccggacgggcgcttcctg
tacgcgaccaatcgcggcgacgcgaacgacatcgtgatctacgcggtgaacgcggccgac
ggcaagctgacgctcgtcggccggcagtcgagcctcggcaagacgccgcgcgagttcgcg
atcgacccgagcggcaagtggctcatcgtcggcaaccaggacagcgacagcgtgttcgtg
ttccggcgcgacatcgcgagcggccggctcgagccgaatccggcgcggatcaggatcgac
aagccggtcgatttcaaattcgtgccggtgcagtga

DBGET integrated database retrieval system