KEGG   Burkholderia pseudomallei MSHR511: BBQ_3843Help
Entry
BBQ_3843          CDS       T03012                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00020  Citrate cycle (TCA cycle)
bpsm00190  Oxidative phosphorylation
bpsm00650  Butanoate metabolism
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
bpsm01120  Microbial metabolism in diverse environments
bpsm01130  Biosynthesis of antibiotics
bpsm01200  Carbon metabolism
Module
bpsm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpsm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpsm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBQ_3843
   00650 Butanoate metabolism
    BBQ_3843
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BBQ_3843
Enzymes [BR:bpsm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BBQ_3843
    1.3.5.4  fumarate reductase (quinol)
     BBQ_3843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AHG38633
LinkDB All DBs
Position
2:370555..371262
Genome map
AA seq 235 aa AA seqDB search
MADTRILDIYRYDPDDGRAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGV
CGSDAMNINGRNGLACVTSMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLV
NEGVPPERERLQTPQEREQLDGLYECILCACCSSACPSYWWNPDKFIGPAGLLQAYRFIV
DSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacccgcattctcgacatctaccgctacgatccggacgacgggcgcgcgccg
cgcatgcagcgctatgagctcgcgccgcgcgcggaagaccggatgctgctcgacgtgctc
ggccgcgtgaaggcgcaggacgagacgctgtcgtatcgccgctcgtgccgcgagggcgtg
tgcggctccgacgcgatgaacatcaacggccgcaacgggctcgcctgcgtgacgagcatg
caggcgctgccgcgcgaaatcgtgctgcggccgctgccggggctgcccgtcgtgcgcgat
ctgatcgtcgacatgacgagcttcttcaatcagtaccattcggtccgcccgtatctcgtc
aacgaaggcgtgccgcccgaacgagagcgcctgcagacgccgcaagagcgcgagcagctc
gacggcctctacgaatgcatcctgtgcgcgtgctgctcgagcgcgtgcccgagctactgg
tggaatcccgacaagttcatcgggccggcggggctgctgcaggcgtaccgcttcatcgtc
gattcgcgtgacgacgcgagcgccgcgcgcctcgacgatctcgaggacccgtaccggctg
ttccgctgccggaccatcatgaactgtgtcgatgtctgtccgaaaggcctgaacccggcg
cgcgcgatcggacagatccgcacgatgctcgcgcggcgcgcggtatag

DBGET integrated database retrieval system