KEGG   Burkholderia pseudomallei MSHR511: BBQ_453
Entry
BBQ_453           CDS       T03012                                 

Gene name
phnG
Definition
(GenBank) phosphonate C-P lyase system protein PhnG
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_453 (phnG)
Enzymes [BR:bpsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BBQ_453 (phnG)
SSDB
Motif
Pfam: PhnG TetR_C_11 Collagen
Other DBs
NCBI-ProteinID: AHG33316
LinkDB
Position
1:474701..475249
AA seq 182 aa
MSASAVSSLHAARRDWLAVLAKIPRDELERALDRVLDGAPAPAFDWLRAPEIGLAMVRGR
IGGTGDPFNLGEASVTRAALRLRGDRTNGTNGTTGADGMNGANGANRPHGATVGIAYVLG
RDKRRAELVALADALLQTPERHERLRAALIEPFRARLAQARAARSGEIATTRVEFFTMVR
GE
NT seq 549 nt   +upstreamnt  +downstreamnt
atgagcgcctcagccgtttcctccttgcatgccgcgcgacgcgactggctcgcggtgctg
gcgaagattccccgcgacgaactcgagcgggcgctcgatcgcgtgctcgacggcgcgccc
gcgcccgcgttcgactggctgcgcgccccggagatcgggctggcgatggtgcgcgggcgc
atcggcggcacgggcgatccgttcaatctcggcgaggcgagcgtcacgcgcgccgcgctg
cgcctgcgcggcgaccgcacgaacggcacgaacggcacgaccggcgcggatgggatgaat
ggtgcgaacggtgcgaaccgcccgcacggcgcgacggtcggcatcgcttacgtgctcggc
cgcgacaagcggcgcgcggagctcgtcgcgctcgccgacgcgctattgcagacgccggag
cgccatgagcggctgcgcgccgcgctgatcgagccgtttcgcgcacgccttgcgcaagcg
cgtgcggcgcgctcgggggaaatcgcgacgacgcgcgtcgaattcttcacgatggtgcga
ggcgaatga

DBGET integrated database retrieval system