KEGG   Burkholderia pseudomallei MSHR511: BBQ_454
Entry
BBQ_454           CDS       T03012                                 

Gene name
phnH
Definition
(GenBank) phosphonate C-P lyase system protein PhnH
  KO
K06165  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH [EC:2.7.8.37]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_454 (phnH)
Enzymes [BR:bpsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BBQ_454 (phnH)
SSDB
Motif
Pfam: PhnH
Other DBs
NCBI-ProteinID: AHG33212
LinkDB
Position
1:475252..475875
AA seq 207 aa
MIDTRFSLADVAPGFADPVQATQRVFRTLLDAMARPGTPGRIEPIGANGSDAAPAMRVAP
AAFASLLTLCDASTPVFLGAPDAALASALRFHTGAPIAAEPRAACFAYLDDANALPPLQC
FASGAPQTPEHAVTLFVRVASLADGEPRTLRGPGIRDARTIAPAGLPDAFWRERAQFAPR
FPCGIDCYLVCGDMLIGLPRTTIVEAC
NT seq 624 nt   +upstreamnt  +downstreamnt
atgatcgatacgcgtttctcgctcgccgatgtcgcgcccggcttcgcggatccggtgcaa
gccacgcagcgcgtgttccgcacgctgctcgacgcgatggcgcgccccggcacgcccggg
cgcatcgagccgatcggcgcgaacggctcggacgccgcgccggcgatgcgcgtcgcgccc
gcggcgttcgcgtcgctgctcacgctgtgcgacgcgtccacgccggtgtttctcggcgcg
ccggacgcggcgctcgcgtcggcgctgcgcttccatacgggcgcgccgatcgccgccgag
ccgcgcgccgcgtgcttcgcctacctcgacgacgcgaacgcgctgccgccgctgcagtgc
ttcgcgagcggcgcgccgcagacgcccgagcatgcggtgacgctgttcgtgcgcgtcgcg
tcgctcgcggacggcgagccgcgcacgctgcgcgggccgggcattcgcgacgcgcgcacg
atcgcgccggcgggcttgcccgatgcattctggcgcgagcgcgcgcaattcgccccgcgc
tttccgtgcggaatcgattgctacctggtgtgcggcgacatgctgatcggcctgccgcgc
acgacgatcgtggaggcatgctga

DBGET integrated database retrieval system