KEGG   Burkholderia pseudomallei MSHR511: BBQ_455
Entry
BBQ_455           CDS       T03012                                 

Definition
(GenBank) bacterial phosphonate metabolism family protein
  KO
K06164  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI [EC:2.7.8.37]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_455
Enzymes [BR:bpsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BBQ_455
SSDB
Motif
Pfam: PhnI PhnG
Other DBs
NCBI-ProteinID: AHG36182
LinkDB
Position
1:475875..477083
AA seq 402 aa
MYVAVKGGERAIEASWRLLDQARRGDPAVPELSVAQIREQQRLAVARVMTEGSLYDEALA
ALAIKQAAGDLVEAIFLLRAYRTTLPRFGYTAPIDTGAMRLERRISATFKDIPGGQLLGP
TYDYTQRLLDFALLAEGGAARHEPHEAESARAAADAGSPPPHATHAPPPAAARVIALLND
EGLIEEERPTAVGAEPGDLSREPLAFPADRATRLQNLARGDEGFLLAMGYATQRGYGHSH
PFAGELRFGAVAVEMALDELDGETIEIGELDVTECQMINHFSGGDGEPPRFTQGYGLAFG
HSERKAIAMALVDRALRASELGEAAHSPPQDQEFVLSHSDNVEASGFVQHLKLPHYVDFQ
SELELVRRLRAGHAAQAGAGANAHENAPARAERADTHTEESR
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgtacgtggcagtcaagggcggcgagcgggcgatcgaggcgtcgtggcgtttgctcgac
caagcgcggcgcggcgaccccgccgtgcccgagctgagcgtcgcgcagattcgcgagcag
cagcgcctcgcggtcgcgcgcgtgatgacggaaggctcgctgtacgacgaggcgctggcg
gcgctcgcgatcaagcaggcggcgggcgatctcgtcgaggcgatcttcctgctgcgcgca
taccggacgacgctgccgcgcttcggctacaccgcgccgatcgataccggcgcgatgcgg
ctcgagcgacggatctcggcaacgttcaaggacatcccgggcggccagttgctcggcccg
acctacgattacacgcagcggctgctcgatttcgcgctgctcgccgaaggcggcgcagcg
cggcacgagccgcacgaggccgaatcggcgcgcgccgcggccgacgcaggctcgccgccg
ccgcatgcgacgcatgcgccgccgcccgcggctgcgcgcgtgatcgcgctcctgaacgac
gaaggcctgatcgaagaggagcggccgacggcggtcggcgccgagccgggcgacctgtcg
cgcgagccgctcgcgtttccggccgatcgcgcgacgcgcctgcagaatctcgcacgcggc
gacgaaggttttctgctcgcgatgggctacgcgacgcagcgcggctacggtcattcgcat
ccgttcgcgggcgagctgcgctttggcgccgtcgccgtcgaaatggcgctcgacgagctc
gacggcgagacgatcgagatcggcgagctcgacgtgaccgagtgccagatgatcaaccat
ttttccggcggcgacggcgagccgcctcgcttcacgcagggctacggcctcgcgttcggc
cattcggagcgcaaggcgatcgcgatggcgctcgtcgatcgcgcgctgcgcgcgtccgag
ctcggcgaagccgcgcactcgccgccgcaggatcaggagttcgtgctgtcgcacagcgac
aacgtcgaggcgtccggcttcgtccagcacctgaagctgccgcactacgtcgatttccag
tccgagctcgagctcgtgcgccgcctgcgcgccgggcatgcggcgcaggcgggagcgggc
gcgaacgcgcacgagaacgcgcccgcccgcgccgaacgcgccgacacgcacaccgaggag
tcccgatga

DBGET integrated database retrieval system