KEGG   Burkholderia pseudomallei MSHR511: BBQ_458
Entry
BBQ_458           CDS       T03012                                 

Gene name
phnL
Definition
(GenBank) phosphonate C-P lyase system protein PhnL
  KO
K05780  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL [EC:2.7.8.37]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_458 (phnL)
Enzymes [BR:bpsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BBQ_458 (phnL)
SSDB
Motif
Pfam: ABC_tran AAA_16 AAA_21 SMC_N AAA_29 AAA_22 RsgA_GTPase AAA_30 AAA_33 AAA_23 AAA_28 MMR_HSR1 AAA_18 TsaE AAA_25 AAA_14 NTPase_1 cobW Rad17 IstB_IS21
Other DBs
NCBI-ProteinID: AHG35096
LinkDB
Position
1:478905..479627
AA seq 240 aa
MLRAVGVGKTFTLHAHGGMTIDALENVSLDVEAGECVALTGPSGAGKSTLLRCLYGNYLA
NRGTIAVRAGARAAEHVVLTASEPHEVIALRRDVIGYVSQFLRAIPRVPALALVAAPLVA
RGMPEGDAADRAAHLLARLNVPRRLWTLAPATFSGGEQQRVNIARGLIAEHPVLLLDEPT
ASLDAENRDVVAELIGDVRRRGAAIVGIFHDEATRERVATRCFPLRPPSRARLPFDEVNA
NT seq 723 nt   +upstreamnt  +downstreamnt
atgctgcgcgcggtcggcgtcggcaagacgttcacgctgcatgcgcacggcggcatgacg
atcgacgcgctcgagaacgtgtcgctcgatgtcgaagcgggcgagtgcgtcgcgctcacg
gggccgtccggcgcgggcaagagcacgctgctgcggtgcctgtacggcaactatctcgcg
aaccgcggcacgatcgcggtgcgcgccggcgcgcgcgcggcggagcacgtcgtgctgacg
gcgtccgagccgcacgaggtgatcgcgctgcggcgcgacgtgatcggctacgtcagccag
ttcctgcgggcgattccgcgggtgccggcgctcgcgctcgtcgccgcgccgctcgtcgcg
cgcggcatgcccgaaggcgatgcggccgatcgcgcggcgcatctgctcgcgcgcctgaac
gtgccgcgccggctgtggacgcttgcgcccgcgacgttttcgggcggcgagcagcagcgc
gtgaacatcgcgcgcgggctgatcgccgagcatccggtgctgctgctcgacgagccgacg
gcgtcgctcgacgcggagaatcgcgacgtcgtcgccgagctgatcggcgacgtgcgccgg
cgcggcgcggcgatcgtcggcatctttcacgacgaagcgacgcgcgagcgcgtcgcgacg
cgctgtttcccgctgcgcccgccgtcgcgcgcgcggctgccctttgacgaagtgaacgct
tag

DBGET integrated database retrieval system