KEGG   Burkholderia pseudomallei MSHR511: BBQ_459
Entry
BBQ_459           CDS       T03012                                 

Gene name
phnM
Definition
(GenBank) phosphonate metabolism protein PhnM
  KO
K06162  alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase [EC:3.6.1.63]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_459 (phnM)
Enzymes [BR:bpsm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.63  alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase
     BBQ_459 (phnM)
SSDB
Motif
Pfam: Amidohydro_1 Host_attach
Other DBs
NCBI-ProteinID: AHG32860
LinkDB
Position
1:479639..480772
AA seq 377 aa
MLISNARVVTRDDVFIGTVQIDGESIRAVSRGTTAARDADDWGGDYLLPGLVELHTDNLE
KHLAPRPGVYWNVDAAFVTHDAQVAAAGITTVFDALAIGTRLNVGVRGRDVQTQCADALA
RFASHGLLRAEHFLHLRCEIATEDVVDVFDSLARHPRLRLASVMDHTPGQRQWKDPQQWR
HYQERHRKWSDEEAATTIAELADEQQRYADAHRRAIVARCRALGVPVASHDDTVIEHVEQ
AAREGIALAEFPTTHAAAEAARARGIATVMGAPNLVRGGSHSGNVSALALARAGLLDILS
SDYVPSSLLCAAFDLVHQAHWSLPRAIDTVSGSPARHTGLRDRGEIAPGLRADFVRVALH
GTLPVPRATYVRGRRVV
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgttgatcagcaatgcgcgcgtcgtcacgcgcgacgacgttttcatcggcaccgtgcag
atcgacggcgaatcgatccgcgcggtgtcgcgcgggacgaccgccgcgcgcgacgccgac
gattggggcggcgactatctgctgcccgggctcgtcgagctgcataccgacaacctggag
aagcatctcgcgccgcggccgggcgtgtactggaacgtcgatgcggcgttcgtcacgcac
gacgcgcaggtcgcggcggcaggcatcacgacggtgttcgacgcgctcgcgatcggcacg
cggctgaacgtcggcgtgcgcgggcgcgacgtgcagacgcagtgcgcggacgcgctcgcg
cgcttcgcgtcgcacgggctgctgcgcgccgagcacttcctgcacctgcgctgcgagatc
gcgacggaggacgtcgtcgacgtgttcgattcgctcgcgcgccatccgcgcctgcggctc
gcgtcggtgatggaccatacgccggggcagcggcagtggaaggatccgcagcaatggcgc
cactatcaggagcggcatcgcaagtggtccgacgaggaggcggcgacgacgatcgccgag
ctggccgacgagcagcagcgctacgcggacgcgcaccggcgcgcgatcgtcgcgcgctgc
cgcgcgctcggcgtgcccgtcgcgagtcatgacgacacggtgatcgagcacgtcgagcag
gcggcgcgggagggcatcgcgctcgccgagtttccgacgacgcacgcggcggccgaagcg
gcgcgcgcacgcggcatcgcgacggtgatgggcgcgccgaacctcgtgcgcggcggctcg
cattcgggcaatgtgtcggcgctcgcgctcgcgcgggcggggctcctcgatatcctgtcg
tccgactacgtgccgtcgagcctgctgtgcgcggcgttcgacctcgtgcaccaggcgcac
tggagcctgccgcgcgcgatcgacacggtgtcgggctcgccggcgcgccatacggggctt
cgcgatcgcggcgaaatcgcgccggggctgcgtgcggatttcgtgcgtgtcgcgctgcac
ggcacgctgcccgtgccgcgcgcgacatatgttcgcgggcgccgcgtcgtgtag

DBGET integrated database retrieval system