KEGG   Burkholderia pseudomallei MSHR511: BBQ_5363
Entry
BBQ_5363          CDS       T03012                                 

Definition
(GenBank) P-hydroxycinnamoyl CoA hydratase/lyase
  KO
K18383  feruloyl-CoA hydratase/lyase [EC:4.1.2.61]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00998  Biosynthesis of various secondary metabolites - part 2
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BBQ_5363
Enzymes [BR:bpsm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.61  feruloyl-CoA hydratase/lyase
     BBQ_5363
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AHG37708
LinkDB
Position
2:complement(2350742..2351569)
AA seq 275 aa
MSYEGRWKTVEVIVDGAIAWVTLNRPDKRNAMSPTLNAEMIDVLEAIELDPEARVLVLTG
EGEAWTAGMDLKEYFREVDAGPEILQEKIRRDASRWQWQLLRMYAKPTIAMVNGWCFGGG
FSPLVACDLAIAADEAVFGLSEINWGIPPGNLVSKAMADTVGHRQALYYIMTGETFTGAQ
AAQMGLVNRSVPRAQLRDAVRALAAKLLDKNPVVLRNAKHGFKRCRELTWEQNEDYLYAK
LDQAQLRDPEHGREQGLKQFLDDKTIKPGLQAYRR
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagttacgaaggtcgctggaaaaccgtcgaggtgatcgtcgacggcgcaatcgcatgg
gtgacgctgaatcgtcccgacaagcgcaacgcgatgagcccgacgctgaacgcggagatg
atcgacgtgctggaggcgatcgagctcgaccccgaagcgcgggtgctcgtgctgacgggc
gagggcgaggcgtggacggccggcatggacctgaaggagtactttcgcgaagtcgacgcc
ggccccgagatcctgcaggagaagatccgccgcgacgcgagccgctggcagtggcagttg
ctgcgcatgtatgcgaagccgacgatcgcgatggtcaacggctggtgcttcggcggcggg
ttctcgccgctcgtcgcgtgcgatctcgcgatcgcggccgacgaggccgtgttcggcctg
tcggagatcaactggggcattccgcccggcaatctcgtcagcaaggcgatggccgatacg
gtcggccatcgtcaggcgctgtactacatcatgacgggcgagaccttcacgggggcgcag
gccgcgcagatggggctcgtcaaccggagcgtgccgcgcgcgcaactgcgcgacgcggtg
cgcgcgctcgccgcgaagctgctcgacaagaatccggtcgtgctgcgcaacgcgaagcac
ggcttcaagcgctgccgcgagctcacgtgggagcagaacgaggactacctgtacgcgaag
ctcgatcaggcgcagttgcgcgatcccgagcacgggcgcgagcagggcctcaagcaattc
ctcgacgacaagacgatcaagccgggcttgcaggcgtacaggcgttga

DBGET integrated database retrieval system