KEGG   Burkholderia pseudomallei MSHR511: BBQ_5586
Entry
BBQ_5586          CDS       T03012                                 

Gene name
aepY
Definition
(GenBank) phosphonopyruvate decarboxylase
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm00998  Biosynthesis of various secondary metabolites - part 2
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
bpsm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_5586 (aepY)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BBQ_5586 (aepY)
Enzymes [BR:bpsm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     BBQ_5586 (aepY)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C
Other DBs
NCBI-ProteinID: AHG36595
LinkDB
Position
2:2615176..2616402
AA seq 408 aa
MKTEDLIGILTDAGVDLAVGVPDSLLKSFCGRLNDPDCPLRHLVASSEGGAVGIAIGHHL
ATGGLAAVYMQNSGIGNAINPLVSLADRAVYGIPLVLIVGWRAEISASGAQVHDEPQHVT
QGRITLPLLDALSIRHLVLERAGGENDALAPSIAQLIAGARQTSQPVALVVRKDAFDDAS
ASRPGAAAPHAGRMTREQAIALIVEHADAGTAIVSTTGVASRELYELRDRLGHSHARDFL
TVGGMGHASQIAVGIALARPAQKVICIDGDGALLMHMGGLAYCAGAPNLTHVVINNGVHD
SVGGQPTLAAHLRLSHIAASCGYAFSRSVATPIELESALHHASRLDGSAFIEVTCRPGYR
SDLGRPRTSPAENKRHFMAFLSRNGATHERDDHAQESGLQDAVQCARH
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaaaacggaagacctgatcggcatactgaccgatgccggcgtcgatctcgcggtcggc
gttccagattccttactgaaatcgttctgcggccggctgaacgatccggattgcccgctg
cgccacctcgtcgcgagcagcgagggcggcgcggtcggcatcgcgatcggccaccatctc
gcaacgggcggcctcgcggccgtctacatgcagaactccggcatcggcaacgcgatcaac
ccgctcgtgtcgctcgccgatcgcgcggtctatgggattccgctcgtgctgatcgtcggc
tggcgcgcggaaatctcggcaagcggcgcacaggtacacgacgagccgcagcacgtgacg
caaggccgcatcacgctgccgctgctcgacgcgctgtcgatccgccacctcgtgctcgag
cgcgccggcggcgaaaacgacgcgctcgcgccgtcgatcgcgcaattgatcgccggcgcg
cgccaaacgtcgcagcccgtcgcgctcgtcgtgcgcaaggacgcgttcgacgacgcgagc
gcctcgcggccgggcgcggccgccccgcacgccggccggatgacccgcgagcaggccatc
gcgctgatcgtcgagcacgcggacgcaggcacggcgatcgtctcgacgacgggcgtcgcc
tcgcgcgagctgtacgagctgcgcgatcggctcggccactcgcacgcgcgcgatttcctg
acggtcggcggcatggggcacgcgtcgcagatcgcggtcggcatcgcgctcgcccgcccc
gcgcaaaaggtgatctgcatcgacggcgacggcgcgctgctgatgcacatgggcggcctc
gcgtactgcgcgggcgcgccgaacctcacgcacgtcgtcatcaacaacggcgtccacgat
tcggtcggcgggcaacccacgctcgccgcgcacttgcggctgtcgcacatcgcggcgtcg
tgcggctacgcgttcagccgcagcgtcgcgacgcccatcgagctcgagagcgcgctgcat
cacgcgagccgcctcgacggcagcgcattcatcgaagtgacgtgccgccccggctatcgc
agcgatctcggccggccgcgcacgtcgcccgccgagaacaaacgccatttcatggccttc
ctatcccgcaacggagcgacacatgagcgagacgatcacgcgcaggaaagtggcctacaa
gacgctgtccagtgcgctcggcactga

DBGET integrated database retrieval system