KEGG   Burkholderia pseudomallei MSHR511: BBQ_5588
Entry
BBQ_5588          CDS       T03012                                 

Gene name
phnY
Definition
(GenBank) putative phosphonoacetaldehyde dehydrogenase
  KO
K00206  phosphonoacetaldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm01100  Metabolic pathways
bpsm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_5588 (phnY)
Enzymes [BR:bpsm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BBQ_5588 (phnY)
SSDB
Motif
Pfam: Aldedh Phage_holin_3_2
Other DBs
NCBI-ProteinID: AHG37001
LinkDB
Position
2:2617255..2618727
AA seq 490 aa
MLNHRSAAFARVARALDARGKTSSGATLIVSHPYNRETVAELPLDSGDDARRKLQRAARF
RSALSRHERIAVFDKAIALLAAEKRDASILITLESGLCRKDTMYEVDRVINVLHAAIAEL
NRDDGQTFSCDNATSDERRKIFTVREPLRGVIVAITPFNHPMNQVAHKICPAIASNNRIV
LKPSEKTPLSALYLLDLFREAGLPEPMFDVVIGEPNALGAALVCDEHVELVAFTGSVAVG
KRIAQMAGYRRTVLELGGNDPLIVMEDADLERAAQLAAKGSYKNSGQRCTAVKRILVERT
VARPFTELLVEHSRRWQTGDPMDERVDIGTLIDDAAAIECARRVDEARDAGARVLLGHQR
DGAAYAPTVLERVGPALRLVQQETFGPVSPVITFCGLDEAVAIANSTRYGLSSGVCTNRL
DYITHLIAHLDVGTVNVWEVPGFRLESTPFGGVKDSGLGSKEGMQEAIKNFTNLKTYSLP
WDTLAHPHAA
NT seq 1473 nt   +upstreamnt  +downstreamnt
ttgctcaatcaccgctccgccgctttcgcgcgcgttgcccgcgcgctcgacgcccgcggc
aagacgtcgtccggcgcgacgctcatcgtcagtcatccgtacaatcgggaaacggttgcc
gagctgccgctcgacagcggcgacgatgcgcgccgcaagctgcagcgcgccgcgcgcttt
cgcagcgcgctcagccggcacgagcgcatcgccgtgttcgacaaggcgatcgcgctgctc
gcggcggaaaagcgcgatgcgtcgattctcatcacgctcgaatcgggcctgtgccgcaag
gacacgatgtacgaggtcgatcgcgtgatcaacgtgctgcacgcggcgatcgcggaactg
aaccgggacgacggccagactttctcgtgcgacaacgcgacgagcgacgagcgccgcaag
atcttcacggttcgcgagccgctgcgcggcgtcatcgtcgcgatcacgccgttcaaccat
ccgatgaaccaggtcgcgcacaagatctgcccggcgatcgcgtcgaacaaccggatcgtg
ctcaagccgtcggagaagacgccgctgtcggcgctgtacctgctcgacctgtttcgcgag
gcgggcctgcccgagccgatgttcgacgtcgtgatcggcgagccaaacgcgctcggcgcg
gcgctcgtttgcgacgagcatgtcgagctcgtcgcgttcaccggcagcgtcgcggtcggc
aagcggatcgcgcagatggccggctatcggcgcacggtgctcgaactcggcggcaacgat
ccgctgatcgtgatggaagacgccgatctcgagcgcgcggcgcagctcgccgccaagggc
tcgtacaagaattccgggcagcgctgcacggcggtcaagcgcattctcgtcgagcgcacg
gtcgcgcgccccttcaccgagctgctcgtcgagcacagccgccgctggcaaaccggcgat
ccgatggacgagcgcgtcgacatcggcacgctgatcgacgatgcggccgcgatcgaatgc
gcgcggcgcgtcgacgaagcgcgcgacgccggcgcgcgcgtgctgctcggccaccagcgc
gacggcgcggcctacgcgcccaccgtgctcgagcgcgtcggcccggcgctgcgcctcgtc
cagcaggaaacgttcggcccggtgtcgcccgtgatcacgttctgcggcctcgacgaagca
gtcgcgatcgcgaacagcacgcgctatgggctgtcgtccggcgtgtgcacgaaccggctc
gactacatcacgcacctgatcgcccatctcgacgtcggcacggtcaacgtgtgggaagtg
ccgggcttccggctggaaagcacgccgttcggcggcgtcaaggattcggggctcggcagc
aaggaaggcatgcaggaggcaatcaagaacttcacgaacctgaagacctattcgctgccg
tgggacaccctcgcgcatccgcacgcggcatga

DBGET integrated database retrieval system