KEGG   Burkholderia pseudomallei MSHR511: BBQ_5850
Entry
BBQ_5850          CDS       T03012                                 

Gene name
phnY
Definition
(GenBank) putative phosphonoacetaldehyde dehydrogenase
  KO
K00206  phosphonoacetaldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm01100  Metabolic pathways
bpsm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_5850 (phnY)
Enzymes [BR:bpsm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BBQ_5850 (phnY)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AHG37727
LinkDB
Position
2:complement(2954177..2955631)
AA seq 484 aa
MTTMPLRDHAAYRRETLRWCGQRAARARTLDVFDPYSGLRVGTVPLATVDDVRRAFDYAV
AYRPALSRYERSQILERAAARLTARAEEASTLISLESGLSKQDSRYEIGRVADVFKFASI
EALRDDAQSYSCDLTPHGKSRRVFSQRQPLDGVIVAITPFNHPMNQVAHKIAPAIATNNR
VIVKPSEKVPLSALYLADVLYEAGLPEPMLQVLTGDPREIADELLTHPSATLITFTGGVA
IGKSIAAKAGYRRIVLELGGNDPLIVLDDADLERAAALAAQGSYKNSGQRCTAVKRILVH
KRVAPRFTELLVEHTRAWTYGDPFDPANRMGTVIDEAAAALFEARVDEAVAQGARLLTGN
ARRGALYAPTVLDRVDASMTLVREETFGPVSPIIAFDTIDDAIRISNGTAFGLSSGVCTD
RADAIVRFINELNVGTVNVWEVPGYRLELTPFGGIKDSGLGYKEGVQEAMKSFTNLKTFS
LPWA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgacgacgatgccgcttcgcgatcacgccgcctaccgccgcgagacgctgcgctggtgc
gggcaacgggcggcgcgtgcgcgcacgctcgacgtattcgatccgtattcggggctgcgc
gtcggcaccgtgccgctcgcgacggtcgacgacgtgcgccgcgcgttcgactatgcggtc
gcgtaccggcctgcgctgtcgcgctacgagcgctcgcagatcctcgagcgcgcggccgca
cgcctcaccgcgcgcgcggaagaggcgtcgacgctgatctcgctcgaatcggggctgtcg
aaacaggattcgcgctacgagatcggccgcgtcgccgacgtgttcaagttcgcgtcgatc
gaggcgctgcgcgacgatgcgcagagctactcgtgcgatctgacgccgcacggcaagtcg
cgccgcgtgttctcgcagcgccagccgctcgacggcgtgatcgtcgcgatcacgccgttc
aatcatccgatgaaccaggtcgcgcacaagatcgcgccggcgatcgcgacgaacaaccgc
gtgatcgtgaaaccgtcggagaaggtgccgctgtcggcgctgtatctcgccgacgtgctg
tacgaagcgggcctgcccgagccgatgctgcaggtgctgacgggcgatccgcgcgagatc
gccgacgaactgctcacgcacccgagcgcgacgctgatcacgtttacgggcggcgtcgcg
atcggcaagtccatcgcggcgaaggcgggctaccggcgcatcgtgctcgagctgggcggc
aacgatccgctgatcgtgctcgacgatgccgatctcgaacgcgcggccgcgctcgccgcg
cagggctcgtacaagaactccggccagcgctgcacggcggtcaagcgcatcctcgtgcac
aagcgcgtcgcgccgcgcttcacggagctgctcgtcgagcacacgcgcgcatggacgtac
ggcgatccgttcgacccggcgaaccggatgggcaccgtgatcgacgaggcggcggccgcg
ctgttcgaggcgcgcgtcgacgaagcggtggcgcagggcgcgcgcctgctgacgggcaac
gcgcggcgcggcgcgctgtatgcgccgacagtgctcgatcgcgttgacgcatcgatgacg
ctcgtgcgcgaggagacgttcggccccgtgtcgccgatcatcgcgttcgatacgatcgac
gacgcgatccgcatcagcaacggcaccgcgttcggcctgtcgtcgggcgtgtgcacggat
cgcgccgacgcgatcgtgcgcttcatcaacgagctgaacgtcggcacggtgaacgtatgg
gaagtgccgggctaccggctcgagctcacgccgttcggcggcatcaaggattccgggctc
ggatacaaggaaggggtgcaggaggcgatgaagagcttcacgaacctgaagacgttttct
ttgccgtgggcgtga

DBGET integrated database retrieval system