KEGG   Burkholderia pseudomallei MSHR511: BBQ_5851
Entry
BBQ_5851          CDS       T03012                                 

Gene name
phnA
Definition
(GenBank) phosphonoacetate hydrolase
  KO
K19670  phosphonoacetate hydrolase [EC:3.11.1.2]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm01100  Metabolic pathways
bpsm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_5851 (phnA)
Enzymes [BR:bpsm01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.2  phosphonoacetate hydrolase
     BBQ_5851 (phnA)
SSDB
Motif
Pfam: Phosphodiest
Other DBs
NCBI-ProteinID: AHG36343
LinkDB
Position
2:complement(2955628..2956869)
AA seq 413 aa
MNRHIEVNGRVYRMPAEPTVAVCVDGCEYDYLEEAASAGVAPFLARMLREGSAFEADCVI
PSFTNPNNLSIVCGAPPSVHGICGNFFWDQNAQGGAGAAVMMNDPAYLRAGTLLAAAADA
GAKVAVVTAKDKLRRLLGWRMRGVCFSAEKANQANLGENGIADVLDFVGLPSPDVYSAAL
SEFVLAAGVRLAQSRRADLMYLSTTDYVQHKCAPGSEGANAFYAMMDRYLAALDALGWVI
GVTADHGMNAKHDPRTGEPNVVYLQDALDAWLGPRLARVILPITDPYVVHHGALGSFATI
YVEQGVDAGTVIGRLREFDGVELALDNATAAERFELPADRIGDVVVVGRRDVVLGTRARE
HDLSGLTVPLRSHGGLSEQRVPLLFNRRIEHVEPGRRLRNFDLFDLALNRTVQ
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaatcgacacatcgaagtcaacggccgcgtctaccggatgccggccgagccgacggtg
gccgtgtgcgtcgacggctgcgaatacgactacctcgaagaagccgcgagcgcgggcgtc
gcgccgttcctcgcgcggatgctgcgcgagggctcggcgttcgaggccgactgcgtgatc
ccgtcgttcaccaacccgaacaacctgtcgatcgtgtgcggcgcgccgccgtcggtgcac
ggcatttgcgggaacttcttctgggaccagaacgcgcagggcggcgcgggcgccgcggtg
atgatgaacgatcccgcctacctgcgcgcgggcacgctgctggcggccgcggcggatgcg
ggcgcgaaggtcgccgtcgtgacggcgaaggacaagctgcgccggctgctcggctggcgc
atgcgcggcgtgtgcttctcggcggagaaggcgaaccaggcgaatctcggcgagaacggc
atcgccgacgtgctcgacttcgtcggcctgccgtcgcccgacgtctacagcgcggcgctg
tcggagttcgtgctcgcggcgggcgtgcggctcgcgcagagccggcgcgcggacctgatg
tacctgtcgacgaccgattacgtgcagcacaaatgcgcgccgggcagcgagggcgcgaac
gcgttctacgcgatgatggaccgctacctcgcggcgctcgacgcgctcggctgggtgatc
ggcgtgaccgcggaccacgggatgaacgcgaagcacgatccgcgaaccggcgagccgaac
gtcgtctatctgcaggacgcgctcgacgcatggctcgggccgcgcctcgcacgcgtgatc
ctgccgatcaccgatccttacgtcgtccaccacggcgcgctcggctcgttcgcgacgatc
tacgtcgagcaaggcgtcgacgcgggcacggtgatcggccggctgcgcgagttcgacggc
gtcgagctcgcgctcgacaacgcgacggccgccgagcgcttcgagctgccggccgaccgg
atcggcgacgtcgtcgtcgtgggccggcgcgacgtcgtgctcggcacgcgcgcgcgcgag
cacgatctgtcgggcttgacggtgccgctgcgctcgcacggcggcctgtccgagcagcgc
gtgccgctgctgttcaaccgccggatcgagcacgtcgagccgggtcgccggctgcgcaac
ttcgatctgttcgacctcgcgctgaaccggaccgtgcaatga

DBGET integrated database retrieval system