KEGG   Burkholderia pseudomallei MSHR511: BBQ_6044
Entry
BBQ_6044          CDS       T03012                                 

Definition
(GenBank) type VI secretion lipofamily protein
  KO
K11906  type VI secretion system protein VasD
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BBQ_6044
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpsm02044]
    BBQ_6044
Secretion system [BR:bpsm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BBQ_6044
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AHG38389
LinkDB
Position
2:3210747..3211250
AA seq 167 aa
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYEL
KADGAFNAADFFTLQGPDKTVLADDLLARERFQLRPGEHRVIRRDADPAAGALGVVAAYR
DLPNSVWRAAYPLPPARDAAWYRFSSPKLKLTIELDTHAIRITEPGK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcatccgaccacccccgttgccgccgtcgcgctcgcgctcgcgtgcgccgcgtgcgcg
agcggcgcggccaagcagaaggagccgctgcggctcgagctcgccgtgcgcgccgcgccc
acggtcaatccggacgatcggagccggccggctccgatcgtcgtgagcgtctacgagctg
aaggccgacggcgcattcaacgccgccgatttcttcacgctgcagggcccggacaagacc
gtgctcgccgacgatctgctcgcgcgcgagcgttttcaactgcgccccggcgagcaccgc
gtgatccggcgcgacgccgatccggcggcgggcgcgctcggcgtcgtcgccgcgtaccgc
gatctgccgaactcggtgtggcgcgcggcatatccgctgccgcccgcgcgggacgccgca
tggtatcgcttctcgtcgccgaagctgaagctgaccatcgagctcgacacgcacgcgatc
aggatcaccgaacccggaaaatga

DBGET integrated database retrieval system