KEGG   Burkholderia pseudomallei MSHR511: BBQ_868
Entry
BBQ_868           CDS       T03012                                 

Gene name
acpP
Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00998  Biosynthesis of various secondary metabolites - part 2
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BBQ_868 (acpP)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BBQ_868 (acpP)
SSDB
Motif
Pfam: PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493
Other DBs
NCBI-ProteinID: AHG33601
LinkDB
Position
1:935143..935382
AA seq 79 aa
MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA
EKITTVQQAIDYARANVKA
NT seq 240 nt   +upstreamnt  +downstreamnt
atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa
gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg
gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc
gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system