KEGG   Burkholderia pseudomallei A79A: X996_12Help
Entry
X996_12           CDS       T03498                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00564  Glycerophospholipid metabolism
bpso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    X996_12
Enzymes [BR:bpso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     X996_12
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_oxidored DUF2914
Motif
Other DBs
NCBI-ProteinID: AIV95109
LinkDB All DBs
Position
1:12761..14293
Genome map
AA seq 510 aa AA seqDB search
MTQQNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTSSSSTKLIHGGLRYLE
YKEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLIRIGLFLYDHLAKRELL
PGSRGIDMRRHPAGAPLVDSIKRGFVYSDGWVDDARLVVLNALDAQERGARILTRTKLVS
AERRDGQWHARLQRADGSTLDVLARAIANAAGPWVGEVLHGALGRGAQHSVRLVKGSHII
TPRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYRDDPSRVAIDRDETRYLCES
INRYFKRKISPADVCWTYSGVRPLLEDENADNPSAVTRDYRLELDDGEGAPLLSVFGGKI
TTFRKLAEEATDMLGGALGAARGAWTAGVPLPGGDIANARFAPFAEAFAKRHPWLPAALA
RRYARAYGTRAERVIGRARSLAELGAQLAPGLYEAELRYLRDVEWAGCADDVLWRRSKLG
LHVAPGTLEPVTAALDAWFGAAREAASAAH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaacagaatcgttacgatctgctcgtcgtcggcggcgggatcaacggcgcgggc
atcgcgcgcgatgcggccggccgcggcctgtcggtgctcctctgcgagcaggacgacctc
gcgtcgcacacctcctcttcgagcacgaagctgatccacggcgggttgcgctacctcgaa
tacaaggaattcgggctcgtgcgcaaggcgctgcaggaacgcgaaacgctgctgcgcgcg
gcgccgcacatcatgtggccgctgcgcttcgtgatgccgcacatgccgaacctgcgcccc
gcgtggctcatccggatcggcctcttcctgtacgaccatctcgcgaaacgcgagctgctg
ccgggctcgcgcggcatcgacatgcgccgccatccggcgggcgcgccgctcgtcgattcg
atcaagcgcggcttcgtctattcggacggctgggtcgacgatgcgcggctcgtcgtgctg
aacgcgctcgatgcgcaagagcgcggcgcgcgcatcctcacgcgcacgaagctcgtgtcg
gccgagcgccgcgacgggcaatggcatgcacgactgcaacgcgccgacggctcgacgctc
gacgtgctggcgcgcgcgatcgcgaacgcggcgggcccgtgggtcggcgaagtgctgcac
ggcgcgctcggccgcggcgcgcagcatagcgtgcgcctcgtgaaaggcagccatatcatc
acgccgcgcctgttcgatcacgaccacgcatacatcttccagaatccggacaagcgcatc
atcttcgcgattccgtacgaacgcgacttcacgctgatcggcacgaccgacgtcgaatac
cgcgacgatccgtcgcgcgtcgcgatcgaccgcgacgaaacgcgctatctgtgcgagtcg
atcaaccgctatttcaagcgtaagatctcgcccgccgacgtatgctggacctactccggc
gtgcgcccgctgctcgaggacgagaacgcggacaacccgtccgccgtcacgcgcgactac
cgcctcgagctcgacgacggcgaaggcgcgccgctgctgtcggtgttcggcggcaagatc
acgacgtttcgcaagctcgccgaagaggcaaccgacatgctgggcggcgcgctcggcgcg
gcgcgcggcgcatggacggcgggggtgccgctaccgggcggcgacatcgcgaacgcgcgc
ttcgcgccgtttgccgaggcgttcgcgaaacgccacccgtggctgcccgccgcgctcgcg
cgccgctatgcgcgcgcgtacggcacgcgcgccgagcgcgtgatcgggcgggcccggtcg
ctcgccgagctcggcgcgcagctcgcgcccggcctctacgaagcggaattgcgttatctg
cgcgacgtcgaatgggcgggttgcgcggacgacgtgctgtggcggcgttcgaagctcggc
ctgcatgtcgcgccgggcacgctcgagcccgtgacggccgcgctcgacgcctggttcggc
gccgcgcgcgaagcggcgagcgccgcgcactga

DBGET integrated database retrieval system