KEGG   Burkholderia pseudomallei A79A: X996_1446Help
Entry
X996_1446         CDS       T03498                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
bpso  Burkholderia pseudomallei A79A
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    X996_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AIV97549
LinkDB All DBs
Position
1:complement(1621155..1621949)
Genome map
AA seq 264 aa AA seqDB search
MSLPHIDPLYSLSGLFVGFLVGLTGVGGGSLMTPILVLLFNVHPATAVGTDLLYAALTKA
TGTFVHGLKGTVEWRITGRLAAGSVPAAAITLWFLHAHGMHSQETSRMIQFVLGAALLLT
SLSLLLRPQLAAFAAKRTRALPPNPTRTLAATVLTGAVLGVLVSLTSVGAGAIGVTVLLL
LYPALSTTRIVGSDIAHAVPLTLVAGVGHWMLGSVDWAMLVSLLIGSVPGIVVGSHLSAR
APEGLLRRVLAATLVAVGAKLVLS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgccccatatcgatccgctgtattccctgtccggcctcttcgtcggttttctc
gtcggcttgacgggcgtcggcggcggttcgctgatgacgccgatcctcgtgctgctgttc
aacgtccatccggcgacggcggtgggcaccgatctgctttacgcggcgctcaccaaggcg
acgggcaccttcgtgcacgggctcaagggcacggtcgaatggcggatcaccgggcgtctc
gcggcgggcagcgtgcccgccgccgcgatcacgctgtggttcctgcatgcgcacggcatg
cattcgcaggaaacgagccggatgatccagttcgtgctcggcgccgcattgctgctcacg
tcgctgtcgctgctgttgcgcccgcagctcgccgcgttcgccgcgaagcgcacgcgcgcg
ctgccgcccaacccgacgcgcacgctcgccgcgaccgtgctcacgggcgccgtgctcggc
gtgctcgtgtcgctgacctcggtcggcgcgggcgcgatcggcgtgacggtcctgctgctg
ctgtacccggcgctgtcgacgacgcgcatcgtcggctccgacatcgcgcacgcggtcccg
ctcacgctcgtcgcgggcgtcggacactggatgctcggctcggtcgactgggcgatgctg
gtgtcgctgctgatcggatcggtgcccggaatcgtcgtcggcagccatctgtcggcgcgc
gcgcccgaagggctgctgcgccgggtgctcgcggcgacgctcgtcgcggtcggcgcgaag
ctcgtgctgtcctga

DBGET integrated database retrieval system