KEGG   Burkholderia pseudomallei A79A: X996_1992Help
Entry
X996_1992         CDS       T03498                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00473  D-Alanine metabolism
bpso01100  Metabolic pathways
bpso01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    X996_1992 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    X996_1992 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpso01011]
    X996_1992 (alr)
Enzymes [BR:bpso01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     X996_1992 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bpso01011]
 Precursor biosynthesis
  Racemase
   X996_1992 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIV95086
LinkDB All DBs
Position
1:2244008..2245078
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRCHAAQSKVWAIVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTAVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYTPEKYRAAWERARACPGIGQITLMTHFSDADGERGVAEQMATFERGA
QGIAGARSFANSAAVLWHPSAHFDWVRPGIMLYGASPSGRAADIADRGLKPTMTLASELI
AVQTLAKGQAVGYGSMFVAEDTMRIGVVACGYADGYPRIAPEGTPVVVDGVRTRIVGRVS
MDMLTVDLTPVPQAGVGARVELWGETLPIDDVAARCMTVGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgatccacaccgcagctctcgcgaacaacctctccgtc
gtgcgctgccacgccgcccagtcgaaggtctgggcgatcgtcaaggcgaacgcgtacggg
cacggtctcgcgcgcgtctttcccgggctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgaactgggctgggcggggccgatcctgctgctcgag
ggcttcttccggtcgaccgacatcgacgtgatcgaccgctacagcctgacgaccgcggtg
cacaacgacgagcagatgcgcatgctcgagaccgcgcggctgtcgaagcccgtgaacgtc
cagctgaagatgaacagcggcatgaaccggctcggctacacgcccgagaagtaccgggcc
gcctgggagcgcgcgcgcgcatgcccgggcatcggccagatcacgttgatgacccatttt
tcggacgccgacggcgaacgcggcgtggccgagcagatggcgacgttcgagcgcggcgcg
caaggcatcgccggcgcgcgcagcttcgcgaactcggccgccgtgctctggcacccgtcg
gcgcacttcgactgggtgcggcccggcatcatgctgtacggcgcgtcgccgtccggccgt
gcggcggacatcgccgaccggggcctgaagccgacgatgacgctcgcctccgagctgatc
gccgtgcagacgctcgcgaaagggcaggcggtcggctacggatcgatgttcgtcgccgag
gacacgatgcgcatcggcgtcgtcgcgtgcggctatgcggacggctatccgcggatcgcg
cccgagggcacgcccgtcgtcgtcgacggcgtgcgcacgcggatcgtcggccgcgtgtcg
atggacatgctgaccgtcgatctcacgcccgtgccgcaggcgggcgtcggcgcgcgcgtc
gagctgtggggcgagacgctgccgatcgacgacgtcgccgcgcgctgcatgacggtcggc
tacgagctgatgtgcgcggtcgcgccgcgcgtgcccgtgcgtgccgagtaa

DBGET integrated database retrieval system