KEGG   Burkholderia pseudomallei A79A: X996_1996Help
Entry
X996_1996         CDS       T03498                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00480  Glutathione metabolism
bpso00590  Arachidonic acid metabolism
bpso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    X996_1996
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    X996_1996
Enzymes [BR:bpso01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     X996_1996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AIV96541
LinkDB All DBs
Position
1:2249069..2249548
Genome map
AA seq 159 aa AA seqDB search
MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVL
GFPCNQFGKQEPGDASQIGAFCEKNYGVTFPMFGKIDVNGANAHPLYRYLTEEAPGILGL
KAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactgtattcattcaacgcgcaggcgctttcggggggcgaggtgccgctcgag
caataccggggcaaggtgctcctcatcgtcaacacggcgagcgagtgcggattcacgccg
cagtacgcggggctgcagcaactgtacgatcgctttcgcgaacgcgggcttgtcgtgctc
ggctttccgtgcaatcagttcggcaagcaggagccgggcgatgcgtcgcagatcggcgcg
ttctgcgagaagaattacggcgtcacgttcccgatgttcgggaagatcgatgtgaacggc
gcgaacgcgcacccgctataccggtatctgaccgaggaggcgcccggcattctcggcctg
aaggcgatcaagtggaatttcacgaagttcctcgtgaaccgggaaggcgagatcgtgaag
cgctatgcgccgtcgacgaagcccgaggatatcgccgcggacgtcgaaaagctgctttga

DBGET integrated database retrieval system