KEGG   Burkholderia pseudomallei A79A: X996_3219Help
Entry
X996_3219         CDS       T03498                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00860  Porphyrin and chlorophyll metabolism
bpso01100  Metabolic pathways
Module
bpso_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    X996_3219 (cobC)
Enzymes [BR:bpso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     X996_3219 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIV96206
LinkDB All DBs
Position
1:complement(3720046..3720645)
Genome map
AA seq 199 aa AA seqDB search
MDVVLIRHPAVALGTGVCYGASDVPLAAGAAAGAAGIRRRLRSLGVARASRVWSSPLARC
ADVARALAGGVRAPLEIDPRLREIDFGAWEMQSWDAIGRDALDRWSADLMHAREHGGESA
AQFVARVRPAFATLAVAARTSWVLTHAGVIRALASHALDAPLDAMLARPIAMGGIVWLRC
DEGGDSDCARGWRIAHWDE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgtcctgatccgccatccggcggtcgcgctcggcacgggcgtctgctacggc
gcgagcgacgtgccgctcgcggccggcgcggcggcgggcgcggccggcattcggcggcgg
ctgcgctcgctcggcgtcgcgcgcgcgtcgcgcgtgtggtcgagcccgctcgcgcgctgc
gcggacgtcgcgcgcgcgctggcgggcggcgtgcgcgcgccgctcgagatcgatccgcgc
ctgcgcgaaatcgatttcggcgcgtgggagatgcaaagctgggacgcgatcggccgcgac
gcgctcgatcgatggagtgccgatctgatgcacgcgcgcgagcacggcggggagagcgcc
gcgcagttcgtcgcgcgcgtgcggcctgcgttcgcgacgctcgccgtcgcggcgcgcacg
agctgggtgctcacgcatgcgggcgtgatccgcgcgctggcgtcgcacgcgctcgatgcg
ccgctcgacgcgatgctcgcgcggccgatcgcgatgggcggcatcgtatggttgcggtgc
gacgaaggtggcgacagcgattgcgctcgcggctggcgaatcgcgcattgggacgaatga

DBGET integrated database retrieval system