KEGG   Burkholderia pseudomallei A79A: X996_3787
Entry
X996_3787         CDS       T03498                                 

Gene name
phnY
Definition
(GenBank) putative phosphonoacetaldehyde dehydrogenase
  KO
K00206  phosphonoacetaldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00440  Phosphonate and phosphinate metabolism
bpso01100  Metabolic pathways
bpso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    X996_3787 (phnY)
Enzymes [BR:bpso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     X996_3787 (phnY)
SSDB
Motif
Pfam: Aldedh Phage_holin_3_2
Other DBs
NCBI-ProteinID: AIV92498
LinkDB
Position
2:complement(399950..401422)
AA seq 490 aa
MLNHRSAAFARVARALDARGKTSSGATLIVSHPYNRETVAELPLDSGDDARRKLQRAARF
RSALSRHERIAVFDKAIALLAAEKRDASILITLESGLCRKDTMYEVDRVINVLHAAIAEL
NRDDGQTFSCDNATSDERRKIFTVREPLRGVIVAITPFNHPMNQVAHKICPAIASNNRIV
LKPSEKTPLSALYLLDLFREAGLPEPMFDVVIGEPNALGAALVCDEHVELVAFTGSVAVG
KRIAQMAGYRRTVLELGGNDPLIVMEDADLERAAQLAAKGSYKNSGQRCTAVKRILVERT
VARPFTELLVEHSRRWQTGDPMDERVDIGTLIDDAAAIECARRVDEARDAGARVLLGHQR
DGAAYAPTVLERVGPALRLVQQETFGPVSPVITFCGLDEAVAIANSTRYGLSSGVCTNRL
DYITHLIAHLDVGTVNVWEVPGFRLESTPFGGVKDSGLGSKEGMQEAIKNFTNLKTYSLP
WDTLAHPHAA
NT seq 1473 nt   +upstreamnt  +downstreamnt
ttgctcaatcaccgctccgccgctttcgcgcgcgttgcccgcgcgctcgacgcccgcggc
aagacgtcgtccggcgcgacgctcatcgtcagtcatccgtacaatcgggaaacggttgcc
gagctgccgctcgacagcggcgacgatgcgcgccgcaagctgcagcgcgccgcgcgcttt
cgcagcgcgctcagccggcacgagcgcatcgccgtgttcgacaaggcgatcgcgctgctc
gcggcggaaaagcgcgatgcgtcgattctcatcacgctcgaatcgggcctgtgccgcaag
gacacgatgtacgaggtcgatcgcgtgatcaacgtgctgcacgcggcgatcgcggaactg
aaccgggacgacggccagactttctcgtgcgacaacgcgacgagcgacgagcgccgcaag
atcttcacggttcgcgagccgctgcgcggcgtcatcgtcgcgatcacgccgttcaaccat
ccgatgaaccaggtcgcgcacaagatctgcccggcgatcgcgtcgaacaaccggatcgtg
ctcaagccgtcggagaagacgccgctgtcggcgctgtacctgctcgacctgtttcgcgag
gcgggcctgcccgagccgatgttcgacgtcgtgatcggcgagccaaacgcgctcggcgcg
gcgctcgtttgcgacgagcatgtcgagctcgtcgcgttcaccggcagcgtcgcggtcggc
aagcggatcgcgcagatggccggctatcggcgcacggtgctcgaactcggcggcaacgat
ccgctgatcgtgatggaagacgccgatctcgagcgcgcggcgcagctcgccgccaagggc
tcgtacaagaattccgggcagcgctgcacggcggtcaagcgcattctcgtcgagcgcacg
gtcgcgcgccccttcaccgagctgctcgtcgagcacagccgccgctggcaaaccggcgat
ccgatggacgagcgcgtcgacatcggcacgctgatcgacgatgcggccgcgatcgaatgc
gcgcggcgcgtcgacgaagcgcgcgacgccggcgcgcgcgtgctgctcggccaccagcgc
gacggcgcggcctacgcgcccaccgtgctcgagcgcgtcggcccggcgctgcgcctcgtc
cagcaggaaacgttcggcccggtgtcgcccgtgatcacgttctgcggcctcgacgaagca
gtcgcgatcgcgaacagcacgcgctatgggctgtcgtccggcgtgtgcacgaaccggctc
gactacatcacgcacctgatcgcccatctcgacgtcggcacggtcaacgtgtgggaagtg
ccgggcttccggctggaaagcacgccgttcggcggcgtcaaggattcggggctcggcagc
aaggaaggcatgcaggaggcaatcaagaacttcacgaacctgaagacctattcgctgccg
tgggacaccctcgcgcatccgcacgcggcatga

KEGG   Burkholderia pseudomallei A79A: X996_4767
Entry
X996_4767         CDS       T03498                                 

Gene name
phnY
Definition
(GenBank) putative phosphonoacetaldehyde dehydrogenase
  KO
K00206  phosphonoacetaldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00440  Phosphonate and phosphinate metabolism
bpso01100  Metabolic pathways
bpso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    X996_4767 (phnY)
Enzymes [BR:bpso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     X996_4767 (phnY)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AIV94018
LinkDB
Position
2:complement(1672216..1673670)
AA seq 484 aa
MTTMPLRDHAAYRRETLRWCGQRAARARTLDVFDPYSGLRVGTVPLATVDDVRRAFDYAV
AYRPALSRYERSQILERAAARLTARAEEASTLISLESGLSKQDSRYEIGRVADVFKFASI
EALRDDAQSYSCDLTPHGKSRRVFSQRQPLDGVIVAITPFNHPMNQVAHKIAPAIATNNR
VIVKPSEKVPLSALYLADVLYEAGLPEPMLQVLTGDPREIADELLTHPSATLITFTGGVA
IGKSIAAKAGYRRIVLELGGNDPLIVLDDADLERAAALAAQGSYKNSGQRCTAVKRILVH
KRVAPRFTELLVEHTRAWTYGDPFDPANRMGTVIDEAAAALFEARVDEAVAQGARLLTGN
ARRGALYAPTVLDRVDASMTLVREETFGPVSPIIAFDTIDDAIRISNGTAFGLSSGVCTD
RADAIVRFVNELNVGTVNVWEVPGYRLELTPFGGIKDSGLGYKEGVQEAMKSFTNLKTFS
LPWA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgacgacgatgccgcttcgcgatcacgccgcctaccgccgcgagacgctgcgctggtgc
gggcaacgggcggcgcgtgcgcgcacgctcgacgtattcgatccgtattcggggctgcgc
gtcggcaccgtgccgctcgcgacggtcgacgacgtgcgccgcgcgttcgactatgcggtc
gcgtaccggcctgcgctgtcgcgctacgagcgctcgcagatcctcgagcgcgcggccgca
cgcctcaccgcgcgcgcggaagaggcgtcgacgctgatctcgctcgaatcggggctgtcg
aaacaggattcgcgctacgagatcggccgcgtcgccgacgtgttcaagttcgcgtcgatc
gaggcgctgcgcgacgatgcgcagagctactcgtgcgatctgacgccgcacggcaagtcg
cgccgcgtgttctcgcagcgccagccgctcgacggcgtgatcgtcgcgatcacgccgttc
aatcatccgatgaaccaggtcgcgcacaagatcgcgccggcgatcgcgacgaacaaccgc
gtgatcgtgaaaccgtcggagaaggtgccgctgtcggcgctgtatctcgccgacgtgctg
tacgaagcgggcctgcccgagccgatgctgcaggtgctgacgggcgatccgcgcgagatc
gccgacgaactgctcacgcacccgagcgcgacgctgatcacgttcacgggcggcgtcgcg
atcggcaagtccatcgcggcgaaggcgggctaccggcgcatcgtgctcgagctgggcggc
aacgatccgctgatcgtgctcgacgatgccgatctcgaacgcgcggccgcgctcgccgcg
cagggctcgtacaagaactccggccagcgctgcacggcggtcaagcgcatcctcgtgcac
aagcgcgtcgcgccgcgcttcacggagctgctcgtcgagcacacgcgcgcatggacgtac
ggcgatccgttcgacccggcgaaccggatgggcaccgtgatcgacgaggcggcggccgcg
ctgttcgaggcgcgcgtcgacgaagcggtggcgcagggcgcgcgcctgctgacgggcaac
gcgcggcgcggcgcgctgtatgcgccgacagtgctcgatcgcgtcgacgcatcgatgacg
ctcgtgcgcgaggagacgttcggccccgtgtcgccgatcatcgcgttcgatacgatcgac
gacgcgatccgcatcagcaacggcaccgcgttcggcctgtcgtcgggcgtgtgcacggat
cgcgccgacgcgatcgtgcgcttcgtcaacgagctgaacgtcggcacggtgaacgtatgg
gaagtgccgggctaccggctcgagctcacgccgttcggcggcatcaaggattccgggctc
ggatacaaggaaggggtgcaggaggcgatgaagagcttcacgaacctgaagacgttttct
ttgccgtgggcgtga

DBGET integrated database retrieval system