KEGG   Burkholderia pseudomallei A79A: X996_3789
Entry
X996_3789         CDS       T03498                                 

Gene name
aepY
Definition
(GenBank) phosphonopyruvate decarboxylase
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00440  Phosphonate and phosphinate metabolism
bpso00998  Biosynthesis of various secondary metabolites - part 2
bpso01100  Metabolic pathways
bpso01110  Biosynthesis of secondary metabolites
bpso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    X996_3789 (aepY)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    X996_3789 (aepY)
Enzymes [BR:bpso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     X996_3789 (aepY)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C
Other DBs
NCBI-ProteinID: AIV94453
LinkDB
Position
2:complement(402275..403501)
AA seq 408 aa
MKTEDLIGILTDAGVDLAVGVPDSLLKSFCGRLNDPDCPLRHLVASSEGGAVGIAIGHHL
ATGGLAAVYMQNSGIGNAINPLVSLADRAVYGIPLVLIVGWRAEISASGAQVHDEPQHVT
QGRITLPLLDALSIRHLVLERAGGENDALAPSIAQLIAGARQTSQPVALVVRKDAFDDAS
ASRPGAAAPHAGRMTREQAIALIVEHADAGAAIVSTTGVASRELYELRDRLGHSHARDFL
TVGGMGHASQIAVGIALARPAQKVICIDGDGALLMHMGGLAYCAGAPNLTHVVINNGVHD
SVGGQPTLAAHLRLSHIAASCGYAFSRSVATPIELESALHHASRLDGSAFIEVTCRPGYR
SDLGRPRTSPAENKRHFMAFLSRNGATHERDDHAQESGIQDAVQCARH
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaaaacggaagacctgatcggcatactgaccgatgccggcgtcgatctcgcggtcggc
gttccagattccttactgaaatcgttctgcggccggctgaacgatccggattgcccgctg
cgccacctcgtcgcgagcagcgagggcggcgcggtcggcatcgcgatcggccaccatctc
gcaacgggcggcctcgcggccgtctacatgcagaactccggcatcggcaacgcgatcaac
ccgctcgtgtcgcttgccgatcgcgcggtctatgggattccgctcgtgctgatcgtcggc
tggcgcgcggaaatctcggcaagcggcgcacaggtacacgacgagccgcagcacgtgacg
caaggccgcatcacgctgccgctgctcgacgcgctgtcgatccgccacctcgtgctcgag
cgcgccggcggcgaaaacgacgcgctcgcgccgtcgatcgcgcaattgatcgccggcgcg
cgccaaacgtcgcagcccgtcgcgctcgtcgtgcgcaaggacgcgttcgacgacgcgagc
gcctcgcggccgggcgcggccgccccgcacgccggccggatgacccgcgagcaggccatc
gcgctgatcgtcgagcacgcggacgcaggcgcggcgatcgtctcgacgacgggcgtcgcc
tcgcgcgagctgtacgagctgcgcgatcggctcggccactcgcacgcgcgcgatttcctg
acggtcggcggcatggggcacgcgtcgcagatcgcggtcggcatcgcgctcgcccgcccc
gcgcaaaaggtgatctgcatcgacggcgacggcgcgctgctgatgcacatgggcggcctc
gcgtactgcgcgggcgcgccgaacctcacgcacgtcgtcatcaacaacggcgtccacgat
tcggtcggcgggcaacccacgctcgccgcgcacttgcggctgtcgcacatcgcggcgtcg
tgcggctacgcgttcagccgcagcgtcgcgacgcccatcgagctcgagagcgcgctgcat
cacgcgagccgcctcgacggcagcgcattcatcgaagtgacgtgccgccccggctatcgc
agcgatctcggccggccgcgcacgtcgcccgccgagaacaaacgccatttcatggccttc
ctatcccgcaacggagcgacacatgagcgagacgatcacgcgcaggaaagtggcatacaa
gacgctgtccaatgcgctcggcactga

KEGG   Burkholderia pseudomallei A79A: X996_4594
Entry
X996_4594         CDS       T03498                                 

Gene name
aepY
Definition
(GenBank) phosphonopyruvate decarboxylase
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00440  Phosphonate and phosphinate metabolism
bpso00998  Biosynthesis of various secondary metabolites - part 2
bpso01100  Metabolic pathways
bpso01110  Biosynthesis of secondary metabolites
bpso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    X996_4594 (aepY)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    X996_4594 (aepY)
Enzymes [BR:bpso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     X996_4594 (aepY)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N
Other DBs
NCBI-ProteinID: AIV94151
LinkDB
Position
2:1462186..1463367
AA seq 393 aa
MIEAAQFVEAARARGFDWYAGVPCSYLTPFINYVLQDPALHYVSAANEGDAVALVAGATL
GGRRGIAMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGVPDEPQHALMGPITPAM
LDTMEIPWETFPTQADAIGPALDRAIAHMDATGRPYALVMQKGSVAPHALEHASMPERRA
HAAARATPGAAAPSAWPTRHDALARIVARTPADSTVVLASTGFCGRELYALDDRPNQLYM
VGSMGCVTPLALGLALARPDLTVVALDGDGAALMRMGAFATLGAYGPPNLVHLLLDNGAH
ESTGGQATVSQYVSFAGIAAACGYATAIEGDDLGVLDAALDAARAGEQAVEHGGAHFARL
SIRTGVPDGLPRPTVTPVDVKTRLMRHIGAMPA
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgatcgaagccgcgcagttcgtcgaagcggcgcgcgcgcgcggcttcgactggtacgcg
ggcgtgccctgctcgtatctgacgccgttcatcaattacgtgctgcaggacccggcgctc
cattacgtatcggcggccaacgaaggcgacgcggtcgcgctcgtcgcgggcgcgacgctc
ggcggccggcgcgggatcgcgatgatgcagaactcggggctcggcaacgcggtgagcccg
ctcacgtcgctcacgtggacgttcaggctgccgcagctcctgatcgtcacgtggcgcggc
cagccgggcgtgcccgacgagccgcagcacgcgctgatgggcccgatcacgcccgcgatg
ctcgacacgatggaaattccgtgggagacgttcccgacgcaggccgacgcgatcggcccg
gcgctcgatcgcgcgatcgcgcacatggacgcgacgggccgcccgtacgcgctcgtgatg
cagaaaggcagcgtcgcgccgcacgcgctcgagcatgcctcgatgcccgagcgccgcgcg
cacgccgccgcgcgcgcgacgcccggcgcggccgcgccttcggcatggccgacgcgccat
gacgcgctcgcgcggatcgtcgcgcgcacgccggccgactcgacggtcgtgctcgcgtcg
acgggcttctgcggccgcgagctgtacgcgctcgacgatcgcccgaaccagctctacatg
gtcggctcgatgggctgcgtgacgccgctcgcgctcggcctcgcgctcgcgcggccggac
ctgaccgtcgtcgcgctcgacggcgacggcgccgcgctgatgcgcatgggcgcgttcgcg
acgctcggcgcgtacggcccgccgaacctcgtgcatctgctgctcgacaacggcgcgcat
gaatcgacgggcgggcaagccacggtgtcgcaatacgtgtcgttcgcgggcatcgcggcc
gcatgcggctatgcgacggcgatcgagggcgacgatctcggcgtgctcgatgcggcgctc
gacgcggcgcgcgcgggcgagcaggccgtcgagcacggcggcgcgcacttcgcgcgcctg
tcgatccgcacgggcgtgcccgacggcctgccccgcccgacggtgacgcccgtcgacgtg
aaaacgcgcctgatgcgccacatcggcgcgatgccggcctga

DBGET integrated database retrieval system