KEGG   Burkholderia pseudomallei A79A: X996_4595
Entry
X996_4595         CDS       T03498                                 

Definition
(GenBank) 2-aminoethylphosphonate aminotransferase family protein
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00440  Phosphonate and phosphinate metabolism
bpso01100  Metabolic pathways
bpso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    X996_4595
Enzymes [BR:bpso01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     X996_4595
Amino acid related enzymes [BR:bpso01007]
 Aminotransferase (transaminase)
  Class V
   X996_4595
SSDB
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Aminotran_1_2 Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: AIV93757
LinkDB
Position
2:1463382..1464449
AA seq 355 aa
MLLLNPGPVTLTERVRQSLLQPDLCHRESEFFDLQDEARARLVAAYALDPAEWSAVLMTG
SGTAAVESMIAALVPENGKLLVIENGVYGERITQIATQYRIAHDVLKHDWMQAPDLARVA
EKLDADRAITHVAVIHHETTTGRLNDLDALAAVCRARGVRMLVDGVSSFGAEAIDFAGGD
IDALAATANKCLHGVPGAAFVIVRRRALASAASRTYYLDLGRLAKLQDARNTPFTPSVHA
YYALVEALREFDEAGGWRARHARYAALAEQVRAGLAARGMPLVLPDGESSVVLRAYRLPA
GVAYEQLHDGLKARGFVIYAGQGGLSSALFRVSTMGAIEPADVERLLDGFTTLAR
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgctgttgctgaatcccggtcccgtgacgctgacggagcgtgtgcgccaaagcctgctg
cagccggacctgtgccaccgcgaaagcgaattcttcgatctgcaggacgaggcgcgcgcg
cggctcgtcgccgcgtacgcgctcgatccggccgaatggagcgcggtgctgatgacgggc
tccggcacggccgcggtcgagagcatgatcgccgcgctcgtgccggaaaacggcaagctg
ctcgtgatcgagaacggcgtgtacggcgagcggatcacgcagatcgcgacgcagtaccgg
atcgcgcacgacgtgctgaagcacgactggatgcaggcgccggatctcgcgcgcgtcgcc
gagaagctcgacgcggatcgcgcgatcacgcatgtcgcggtgatccatcacgaaacgacc
acgggccgcctgaacgacctcgacgcgctcgccgccgtgtgccgcgcgcgtggcgtgcgc
atgctcgtcgacggcgtgagcagcttcggcgcggaggcgatcgatttcgcgggcggcgac
atcgacgcgctcgccgcgaccgcgaacaagtgcctgcacggcgtgccgggcgcggcgttc
gtgatcgtgcgccgccgcgcgctcgcgagtgccgcgagccgcacctactacctcgatctc
ggccggctcgcgaagctgcaggacgcgcgcaacacgccgttcacgccgtcggtgcacgcg
tactacgcgctcgtcgaggcgctgcgcgagttcgacgaggcgggcggctggcgcgcgcgc
cacgcgcgctacgcggcgctcgccgaacaggtgcgcgccggcctcgccgcgcgcggcatg
ccgctcgtgctgccggacggcgaatcgtcggtcgtgctgcgcgcgtaccggctgcccgcc
ggcgtcgcgtacgagcaactgcacgacggcctgaaagcgcgcggcttcgtgatctacgcg
ggccagggcgggctgtcgagcgcgttgttccgcgtgtcgacgatgggcgcgatcgagccc
gcggacgtcgagcgcctcctcgacggattcaccacgctcgcgcgctga

KEGG   Burkholderia pseudomallei A79A: X996_4773
Entry
X996_4773         CDS       T03498                                 

Gene name
phnW
Definition
(GenBank) 2-aminoethylphosphonate--pyruvate transaminase
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00440  Phosphonate and phosphinate metabolism
bpso01100  Metabolic pathways
bpso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    X996_4773 (phnW)
Enzymes [BR:bpso01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     X996_4773 (phnW)
Amino acid related enzymes [BR:bpso01007]
 Aminotransferase (transaminase)
  Class V
   X996_4773 (phnW)
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2
Other DBs
NCBI-ProteinID: AIV92311
LinkDB
Position
2:1679225..1680334
AA seq 369 aa
MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFNRLTKSVCADLVRIAGGGDAYVCVP
LQGSGTFAVEATLGTLVPRDARVLVPNNGAYCARIAAILRRLGIAHVELPFAEDEPASAH
AIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGRALIVDAMSSFGALPIALA
ASDIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLHDQYAYMQRTSQWRF
TPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALGFEPFLDARAQASVIV
TFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGALGADEMRGAVAAIGGA
LESLGIAMR
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccagaacgtgatcccatcctgttgacgcccggcccgctgacgacctcgcgcatgacg
cgcgacgcgatgctgcgcgactggggctcgtgggacgccgctttcaaccggctgacgaag
agcgtctgcgcggatctcgtgcggatcgcgggcggcggcgacgcatatgtgtgcgtgccg
ctgcaaggcagcggcacgtttgcggtcgaagcgacgctcggcacgctcgtgccgcgcgac
gcccgcgtgctcgtgccgaacaacggcgcgtactgcgcgcggatcgcggcgatcctgcgc
cggctcggcatcgcgcacgtcgagctgccgttcgccgaggacgagccggcgagcgcgcac
gcgatcgacgcggcgctcgcgcgcgacgcgcgcctcacgcacgtcgcgctcgtgcatctg
gagacgagcgccggcctgctgaacccgctcgacgacatcgccgccgtctgccgcgcgcgc
ggcagggcgctgatcgtcgacgcgatgagctcgttcggcgcgctgccgatcgcgctcgcg
gcaagcgacatcgacgcgctgatctcggcgagcggcaagtgcctggaaggagtgcccggc
atgggcttcgcgatcgtgcggcgttcggcgctcgaagcggccgaggggcgctcgccgtcg
gtcgcgctcgatctgcacgaccagtacgcatacatgcagcgcacgtcgcaatggcgcttc
acgccgccgacgcacgtgctcgccgcgctgcgcgccgcgctcgaccagttcttcgacgaa
ggcgggcagccggcgcgcggcgcgcgctacgcgcggaactgcgcgacgctcgtcgacggc
atgcgcgcgctcggcttcgagccgtttctcgacgcgcgcgcgcaggcgagcgtgatcgtc
acgttctacgcgcccgccgatcccgcgtatgcgttcccggcgttctacgcggccgtgcgc
gacgcgggctacgtgctgtatccgggcaagctgacgacggccgacacgtttcgcgtcggc
tgcatcggcgcgctcggcgccgacgagatgcgcggcgcggtggcggcgatcggcggcgcg
ctcgaatcgctcggaatcgcgatgcggtga

DBGET integrated database retrieval system