KEGG   Burkholderia pseudomallei A79A: X996_4768
Entry
X996_4768         CDS       T03498                                 

Gene name
phnA
Definition
(GenBank) phosphonoacetate hydrolase
  KO
K19670  phosphonoacetate hydrolase [EC:3.11.1.2]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00440  Phosphonate and phosphinate metabolism
bpso01100  Metabolic pathways
bpso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    X996_4768 (phnA)
Enzymes [BR:bpso01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.2  phosphonoacetate hydrolase
     X996_4768 (phnA)
SSDB
Motif
Pfam: Phosphodiest
Other DBs
NCBI-ProteinID: AIV93880
LinkDB
Position
2:complement(1673667..1674908)
AA seq 413 aa
MNRHIEVNGRVYRMPAEPTVAVCVDGCEYDYLEEAASAGVAPFLARMLREGSAFEADCVI
PSFTNPNNLSIVCGAPPSVHGICGNFFWDQNAQGGAGAAVMMNDPAYLRAGTLLAAAADA
GAKVAVVTAKDKLRRLLGWRMRGVCFSAEKANQANLGENGIADVLDFVGLPSPDVYSAAL
SEFVLAAGVRLAQSRCADLMYLSTTDYVQHKCAPGSEGANAFYAMMDRYLAALDALGWVI
GVTADHGMNAKHDPRTGEPNVVYLQDALDAWLGPRLARVILPITDPYVVHHGALGSFATI
YVEQGVDAGTVIGRLREFDGVELALDNATAAERFELPADRIGDVVVVGRRDVVLGTRARE
HDLSGLTVPLRSHGGLSEQRVPLLFNRRIEHVEPGRRLRNFDLFDLALNRTVQ
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaatcgacacatcgaagtcaacggccgcgtctaccggatgccggccgagccgacggtg
gccgtgtgcgtcgacggctgcgaatacgactacctcgaagaagccgcgagcgcgggcgtc
gcgccgttcctcgcgcggatgctgcgcgagggctcggcgttcgaggccgactgcgtgatc
ccgtcgttcaccaacccgaacaacctgtcgatcgtgtgcggcgcgccgccgtcggtgcac
ggcatttgcgggaacttcttctgggaccagaacgcgcagggcggcgcgggcgccgcggtg
atgatgaacgatcccgcctacctgcgcgcgggcacgctgctggcggccgcggcggatgcg
ggcgcgaaggtcgccgtcgtgacggcgaaggacaagctgcgccggctgctcggctggcgc
atgcgcggcgtgtgcttctcggcggagaaggcgaaccaggcgaatctcggcgagaacggc
atcgccgacgtgctcgacttcgtcggcctgccgtcgcccgacgtctacagcgcggcgctg
tcggagttcgtgctcgcggcgggcgtgcggctcgcgcagagccggtgcgcggacctgatg
tacctgtcgacgaccgattacgtgcagcacaaatgcgcgccgggcagcgagggcgcgaac
gcgttctacgcgatgatggaccgctacctcgcggcgctcgacgcgctcggctgggtgatc
ggcgtgaccgcggaccacgggatgaacgcgaagcacgatccgcgaaccggcgagccgaac
gtcgtctatctgcaggacgcgctcgacgcatggctcgggccgcgcctcgcacgcgtgatc
ctgccgatcaccgatccttacgtcgtccaccacggcgcgctcggctcgttcgcgacgatc
tacgtcgagcaaggcgtcgacgcgggcacggtgatcggccggctgcgcgagttcgacggc
gtcgagctcgcgctcgacaacgcgacggccgccgagcgcttcgagctgccggccgaccgg
atcggcgacgtcgtcgtcgtgggccggcgcgacgtcgtgctcggcacgcgcgcgcgcgag
cacgatctgtcgggcttgacggtgccgctgcgctcgcacggcggcctgtccgagcagcgc
gtgccgctgctgttcaaccgccggatcgagcacgtcgagccgggtcgccggctgcgcaac
ttcgatctgttcgacctcgcgctgaaccggaccgtgcaatga

DBGET integrated database retrieval system