KEGG   Burkholderia pseudomallei A79A: X996_5136Help
Entry
X996_5136         CDS       T03498                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00260  Glycine, serine and threonine metabolism
bpso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    X996_5136 (tdh)
Enzymes [BR:bpso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     X996_5136 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Methyltransf_25 MTS Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIV93975
LinkDB All DBs
Position
2:complement(2152276..2153307)
Genome map
AA seq 343 aa AA seqDB search
MKALAKLERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTIPVPMH
VGHEYVGEIVEMGQEVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGA
FAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNLVGEDVLITGAGPIGVMAV
AIAKHVGARNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLHMTEGFDVGLEMS
GVPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFKGLEIKGIYGREMFETWYKMVA
MLQSGLDLSPIITHRFAVDDYEKGFAAMLSGESGKVILDWADA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctggcgaaactcgaacgcgggccgggcctcacgctcacccgtgtgaaaaag
ccggaggtcggccacaacgacgtcctcatcaagatccgccgcaccgcgatctgcggcacc
gacatccatatctggaagtgggacgactgggcgcagaagacgattccggtgccgatgcac
gtcggccacgagtacgtcggcgagatcgtcgagatgggccaggaagtgcgcggcttctcg
atcggcgatcgcgtatccggcgaaggccacatcacgtgcggcttctgtcggaactgccgc
gcggggcggcgccatttgtgccgcaacacggtgggcgtcggcgtgaatcgcgaaggcgcg
ttcgccgagtacctcgcgattcccgcgttcaacgcgttcaagattccgcccgagatctcc
gacgatctcgccgcgatcttcgatccgttcggcaacgcgacgcacaccgcgctgtcgttc
aacctcgtcggcgaggacgtgctgatcacgggtgcggggccgatcggcgtgatggcggtg
gcgatcgcgaagcacgtcggcgcgcgcaacgtcgtcatcaccgacatcaacgactatcgc
ctcgaactcgcgcgcaagatgggcgcgacacgcgcggtgaacgtgtcgcgcgaatcgctg
cgcgacgtgatggccgacctgcacatgacggagggcttcgacgtcgggctcgagatgtcc
ggcgtgccgagcgcgttcacgtcgctgctcgaatcgatgaatcacggcggcaaggtcgcg
ctgctcggcattccgcccgcgcagaccgcgatcgactggaaccaggtgatcttcaagggc
ctcgagatcaagggcatctatgggcgcgagatgttcgagacctggtacaagatggtcgcg
atgctgcaaagcgggctcgatctttcgccgatcatcacgcaccgcttcgccgtggacgac
tacgagaaaggtttcgctgcgatgctgtcgggcgaaagcggcaaggtgattctcgactgg
gccgacgcgtga

DBGET integrated database retrieval system