KEGG   Burkholderia pseudomallei A79A: X996_5192Help
Entry
X996_5192         CDS       T03498                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00550  Peptidoglycan biosynthesis
bpso01100  Metabolic pathways
bpso01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    X996_5192
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    X996_5192
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bpso01003]
    X996_5192
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpso01011]
    X996_5192
Enzymes [BR:bpso01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     X996_5192
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     X996_5192
Glycosyltransferases [BR:bpso01003]
 Polysaccharide
  Bacterial polysaccharide
   X996_5192
Peptidoglycan biosynthesis and degradation proteins [BR:bpso01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   X996_5192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AIV93593
LinkDB All DBs
Position
2:2227959..2230478
Genome map
AA seq 839 aa AA seqDB search
MSSFLERCAAWLAAAKPHAVAVLHRLRHPTRRGVLLAVAALPALCVLYVLALIPFTPSIG
DIRKARVDAPAQILSADGKLLAEFKPSNREWVPLADISPKMVDALISTEDHRFYEHHGLD
WRRTAGAALRTFSGDRQGGSTITQQLARNLYPDEIGRAPTLTRKLKEAITALKIEAVYSK
AQILETYLNTVPFLYNAYGVEMAARTYFDKSADQLDALDAATLVGMLKGNSYYNPVLNPE
RALARRNTVLAQMVKYGRLSPAAYASLQKKPLRIDFERQKEPPGPAPHFAQQLRKWLIAW
ADRNDYNIYSDGLVVRTTIDSRLQTYATQALARQTNQLQGVANGMWNAGSGCAPGNPLFR
AFVRETPEFRAALDGGATGDAALKRLLADRGFARALCKAKADVQAGFLAIDPRNGQIKAW
VGSRDFTTEPFDHVQQARRQPGSTFKPFVYGAAFAAGATPDDTFVDQPVEIPLAGGEIWR
PDDDAPPTNKPMTLRDAIAYSRNRITAQLMMKVGPQKVARLARAMGVRDSALDAVPSLAL
GTSPVTLKEMVSAYATIANVGEYVEPRMVTRIEGRNGEVLAEFASATPERALDAAAARTL
IDVMRGVVERGTGAAIRSRYGIRADVAGKTGTTQGDTDGWFILMQPELVAGAWVGFDDGR
VTLGGDWGQGARSALPIVGDFYQRAIRARLVDTRERFATEAPPSAFDTFRNKLGDWYRYL
FEKPEPPRKAAPPKAPRAPLEEVMPASEVEAASAAAARAASEAAAVASAASTASAAPPAS
GVPFAPGGASAPALPPLLPPMPQSAPLPPAAQPGSSLPNDNAPMSPTPTPDAPAAGGSN
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtccttcctcgagcgttgcgcggcctggctcgccgccgcgaagccgcacgccgtc
gccgtcctgcaccgcctgcgccacccgacgcggcgcggcgtgctgctcgccgtcgccgct
ctccccgcgctgtgcgtgctctacgtgctcgcgctgatcccgttcacgccgagcatcggc
gacatccgcaaggcgcgcgtcgacgcgcccgcgcagatcctgtccgccgacggcaagctg
ctcgccgagttcaagccgtcgaaccgcgaatgggtgccgctcgccgacatctcgccgaag
atggtcgacgcgctgatctcgaccgaggaccatcgcttctacgagcaccacggcctcgac
tggcgccgcaccgcgggcgccgcgctgcgcacgttctccggcgaccggcagggcggctcg
acgatcacgcagcagctcgcgcgcaacctgtatccggacgagatcggccgcgcgccgacg
ctcacgcgcaagctgaaggaagcgatcaccgcgctgaagatcgaggcggtctacagcaag
gcgcagatcctcgagacgtatctgaacacggtgccgttcctgtacaacgcgtacggcgtc
gagatggccgcgcgcacgtacttcgacaaatcggccgaccagctcgacgcgctcgacgcg
gcgacgctcgtcggcatgctcaagggcaacagctattacaacccggtgctgaaccccgag
cgcgcgctcgcgcgccgcaacacggtgctcgcgcagatggtgaagtacggcaggctctcg
cccgccgcgtatgcgtcgctgcagaagaagccgctgcgcatcgatttcgagcggcagaag
gagccgcccggccccgcgccgcatttcgcgcagcaactgcgcaagtggctgatcgcgtgg
gccgatcgcaacgattacaacatctactccgacggcctcgtcgtgcgcacgacgatcgat
tcgcggctgcagacgtatgcgacgcaggcgctcgcgcgtcagaccaaccagctgcagggc
gtcgcgaacgggatgtggaacgccggcagcggctgcgcccccggcaatccgctgtttcgc
gcattcgtgcgcgagacgccggagttccgcgcggcgctcgacggcggcgcgaccggggac
gccgcgctcaagcgcctgctcgccgaccgcggcttcgcgcgcgcactctgcaaggcgaag
gccgacgtgcaggcgggctttctcgcgatcgatccgcgcaacgggcagatcaaggcgtgg
gtcggcagccgcgatttcacgaccgagccgttcgatcacgtgcagcaggcgcgccggcag
ccgggctcgacgttcaagccgttcgtctacggcgcggcgttcgcggcgggcgcgacgccc
gacgatacgttcgtcgatcagccggtcgagatcccgctcgcgggcggcgagatctggcgg
cccgacgacgacgcgccgcccacgaacaagccgatgacgctgcgcgacgcgatcgcgtat
tcgcgcaaccggatcaccgcgcaactgatgatgaaggtcggcccgcagaaggtggcgcgc
ctcgcgcgcgcgatgggcgtgcgcgacagcgcgctcgatgcggtgccgtcgctcgcgctc
ggcacgagccccgtgacgctcaaggagatggtgtccgcctacgcgacgatcgcgaacgtc
ggcgaatacgtcgagccgcggatggtcacgcgcatcgagggccgcaacggcgaggtgctc
gccgagttcgcgagcgcgacgcccgagcgcgcgctcgacgcggcggcggcgcgcacgctg
atcgacgtgatgcgcggcgtcgtcgagcgcggcaccggcgcggcgatccgctcgcgctac
gggattcgcgcggacgtcgccggcaagaccggcacgacgcagggcgacaccgacggctgg
ttcatcctgatgcagcccgagcttgtcgcgggcgcgtgggtcggcttcgacgacggccgc
gtgacgctcggcggcgattgggggcaaggcgcgcgcagcgcgctgccgatcgtcggcgat
ttctatcagcgggcgattcgcgcgcggctcgtcgatacgcgcgaacgcttcgcgaccgaa
gcgccgccgagcgcgttcgacacgttccgcaacaagctcggcgactggtatcgctacctg
ttcgagaagcccgagccgccgcgcaaggccgcgccgccgaaagcgccgcgcgcgccgctc
gaggaggtgatgccggcttccgaggtcgaggcggcgtcggcggcggccgcgcgcgccgcg
tcggaagcggctgcagtggcatcggccgcgtcgaccgcatcggccgcaccgccggcgagc
ggcgtgccgttcgcgccgggcggcgcgtcggcgccggcgctgccgccgctgttgccgccg
atgccacagtctgctccgttgccgcctgccgcgcagccgggcagcagcctgccgaacgac
aacgcgccgatgtcgccgacgccgacgcccgatgcgccggccgcgggcggcagcaattag

DBGET integrated database retrieval system