KEGG   Bifidobacterium pseudolongum: AH67_00335Help
Entry
AH67_00335        CDS       T03529                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpsp  Bifidobacterium pseudolongum
Pathway
bpsp00620  Pyruvate metabolism
bpsp00680  Methane metabolism
bpsp01100  Metabolic pathways
bpsp01120  Microbial metabolism in diverse environments
bpsp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AH67_00335
  09102 Energy metabolism
   00680 Methane metabolism
    AH67_00335
Enzymes [BR:bpsp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AH67_00335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIZ15580
UniProt: A0A0A7I8M0
LinkDB All DBs
Position
complement(72837..75593)
Genome map
AA seq 918 aa AA seqDB search
MTDQEQPLTPADTGVVTSGLGTKTPEERKLPDSLSNDMELCLEILRGVLAEYDESLLTMF
DTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDAQLLARAFATYFHLANL
CEENYRVSVLHEREAKVDDKQAIDPVNEMTKAYHQLIAEMGPAQAKELLGRLEFHPVFTA
HPTEARRKAVEGKIRRIAELLSAHKYLGGSDKKENLRRLYNEIDALFRTSPTALKKPTPV
EEADTILDIFDNTLFHTIPQVYRRFDDWVLGDEAGLVEPVCPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLAALEEATRTVGRNMTMESETTPPSDELRALWNQQKEVSERLT
SKASLISTQELHRAVLLVMADRLHYTIKRDHDLMYHTCDDFLADLRIVQRSLAEAGAKRA
AYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDIREHGLHGERGPLQPMTHEVLDT
FRALGAIQRRNGVKAARRYIISFTKSAKNVRDVYELNRLSFANPEDAPVIDVIPLFEQLE
DLENSVNVLDEMIKIPEVQARLKQTGRKLEVMLGYSDSSKDAGPTTATLALHSAQERIAK
WADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPKDSVKCRFKLTEQGEVIFARYGNPVL
AIRHVESVAAATLLQSAPSVEKTNTEMTEKFAPMASKLNEVSHETYLDLLNTPDFAPWFS
TVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGSACETFG
DLDTLRKAYQEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDRDDLRDKVLNEMELTRKW
VLKIVGDAWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSKSQQAGFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcaagagcaaccactcactcctgcggataccggcgtagtcacgtccggcttg
ggcacgaaaacccccgaggaacgcaaactccccgattcgttgagcaacgacatggagttg
tgcctggagatcctgcgcggagtacttgccgaatacgatgaatccctgctcaccatgttc
gacaccgtgcgccagtatgcagtggatgcgagcgcagagcgcttctccggtgtgctcacc
gacacccaccccgaacgcgacgatctggagatggccgtcaagaccatcgacgcgatgaac
ctgcatgacgcgcagctgctcgcccgtgcgttcgccacgtatttccatctggcgaacctg
tgcgaggagaactaccgtgtgtctgtgctgcacgagcgcgaagccaaggtggacgacaag
caggcgatcgaccccgtcaatgaaatgacaaaggcctaccaccagctcatcgccgaaatg
ggaccggcccaagccaaggaactgcttggccgcctcgagttccatccggtgttcaccgca
caccccaccgaggcgcgccgcaaggccgtggagggcaagatccgccgcatcgcggagctg
ctcagcgcccacaagtacttgggcggatcggacaagaaagagaacctgcgccgcctgtac
aacgagatcgatgcgctcttccgcacgtcgccaaccgcgctcaagaagcccacgcctgtt
gaggaagcggacacgattctcgacatcttcgacaacacgctgttccacacgatcccgcag
gtctatcgccgtttcgacgactgggtcctcggcgacgaggccggccttgtggagccggtg
tgcccggcgttcttccaccccggaagctggattggctccgaccgcgatggcaacccgaac
gtcaccgccaaagtgagccgtcaggtggcccgcaagttcagcgaccatgtgctcgccgcg
ctcgaagaggccacgcgcaccgtgggccgcaacatgacgatggaatccgagaccaccccg
ccgagcgatgagctgcgtgcgctgtggaaccagcagaaagaggtcagcgagcgcctgaca
agcaaggcgtcgctcatctccacgcaggaactgcaccgcgcggtgctgctcgtgatggcc
gaccgcctgcactacacgatcaagcgcgaccacgacctcatgtaccacacgtgcgacgac
ttcctggccgacctgcgcatcgtgcagcgttcgctcgccgaagcgggcgccaagcgcgcc
gcgtacggcccgctgcaggatctgatctggcagaccgagaccttcggtttccacatggtc
gagatggagttccgccagcactccgtggtgcacgcccgcgcgctcgacgacatccgcgag
cacggactgcacggcgagcgcggcccgctccagccgatgacgcacgaagtgctcgacacg
ttccgcgcgctcggtgcgatccagcgccgcaacggcgtcaaggccgcgcgccgctacatc
atctcgttcacgaagagcgcgaagaacgtgcgcgacgtctacgagctcaaccgcctgtcg
ttcgcgaaccccgaggatgcgccggtcatcgacgtcatcccactgttcgagcagctcgaa
gaccttgagaactcggtgaatgtgctcgatgaaatgatcaagatccccgaggtgcaggca
cgtctcaagcagaccggccgcaagctcgaggtcatgctcggctactccgactcgtcgaag
gacgccggtcccaccaccgcgacgctcgccctgcactccgcgcaggagcgcatcgcgaag
tgggcggacgagaacgacatcgacctgacgctgttccacggccgcggcggcgccgtcggc
cgcggcggcggcccagcgaaccgcgccgtgctcgcgcagccgaaggattcggtcaagtgc
cgcttcaagctcaccgagcagggcgaggtcatcttcgcgcgctacggcaacccggtgctg
gcgattcgccacgtcgagtccgtggccgcggccacgctgctgcagtccgcgccgagcgtg
gagaagacgaacaccgagatgaccgagaagttcgctccgatggcgagcaagctcaacgaa
gtttcacatgaaacataccttgacctgctcaatacgccggacttcgcgccgtggttctcg
accgtcacgccgctcaccgaaatcggcctgctgccgatcggctcccgccccgccaagcgc
ggcttgggcgcgaagtcgctcgacgacctgcgcacgatcccctggatcttctcgtgggcc
caggcgcgcatcaacctggccgcatggtacggcctcggttcggcgtgcgagacgttcggc
gatctggacacgttgcgcaaggcgtatcaggaatggccgctgttctccacgttcatcgac
aacatcgagatgtcgctcgccaagaccgacgagcgcatcgccaagatgtatctggcgctc
ggcgaccgcgacgacctgcgcgacaaggtgctcaacgagatggagctcacccgcaagtgg
gtgctcaagattgtgggcgacgcatggccgctccagcaccgccatgtgctcggccaggcg
atccgcatccgctcgccgtacgtcgacgcgctttcggtgacacaggtgctcgcattgcgc
tcgctgcgtaagaaggtggacaaggaagagctctcgaagagccagcaggcagggttcatc
tacctgatcctctgcaccgtttcgggcgttgccgccggcctccagaacactggctga

DBGET integrated database retrieval system