KEGG   Bifidobacterium pseudolongum: AH67_01270Help
Entry
AH67_01270        CDS       T03529                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpsp  Bifidobacterium pseudolongum
Pathway
bpsp00473  D-Alanine metabolism
bpsp00550  Peptidoglycan biosynthesis
bpsp01100  Metabolic pathways
bpsp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpsp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AH67_01270
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AH67_01270
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AH67_01270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpsp01011]
    AH67_01270
Enzymes [BR:bpsp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AH67_01270
Peptidoglycan biosynthesis and degradation proteins [BR:bpsp01011]
 Precursor biosynthesis
  Amino acid ligase
   AH67_01270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AIZ15736
UniProt: A0A0A7I6N2
LinkDB All DBs
Position
297762..298904
Genome map
AA seq 380 aa AA seqDB search
MAQLTRVAVMYGGKADEHPISCISVASVLRALDTSRFEPVLIGITKQGEWIVDGEDPRQW
ALDKGLPQVERTPGSRSVVLSIGDGGDGFYARNADGTLESLGHIDVVLPVLHGPYGEDGT
IQGLFEMMGVPYVGCGVLASAAAMDKHYTKTLLAAAGIAVAPGVTLDTRLYDASDRFAAY
GERFLDLVDEAGLQYPLFVKPSRAGSSFGVTKVERVGDAEELAAAVYEASLHDWRVIVEQ
GIDAREIECAVLRPRGEEEPRVSLPGEIVLDRRAQDDDQFYDFDSKYMDAQASHAEVPAH
IPDELIERVRATALKAFLAIDGTGLSRVDTFVTPGGDVLVNEINTMPGFTSISMYPKAWD
ATGIAYTDLITTLILGALHR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactcacgcgcgtggccgtcatgtacggcggcaaggccgacgaacacccgatt
tcatgcatctccgtggcgagcgtgttgcgcgcgctcgatacgagtcgcttcgagccggtg
ctgatcggcatcacgaagcagggcgagtggatcgtggacggtgaggacccgcgccagtgg
gcgctcgacaagggcctgccgcaagtggagcgcacacccggctcacgcagcgtcgtgctg
agcatcggcgacggcggtgacggtttttacgcgcgcaacgccgacggcacactcgaatcc
ctggggcatatcgacgtggtgctgccggtgctgcacggcccgtacggcgaagacggcaca
atccagggcctgttcgagatgatgggtgtgccgtatgtgggctgtggtgtgttggcgagc
gccgcggcgatggataagcattatacgaagacgttgctcgcggccgccggcatcgccgtg
gcgcccggcgtgacgctcgacacgcgcctgtatgacgcgtcggaccgcttcgccgcctac
ggcgagcgtttcctggatctggtggacgaggcggggttgcagtacccgctgttcgtgaag
ccgtcgcgcgccggctcgagtttcggcgtaacgaaggtggagcgcgtgggcgacgcggag
gagctcgctgccgccgtgtatgaggcgagcctgcacgactggcgtgtgattgtggagcag
ggcatcgacgcacgcgagatcgagtgcgcggtgctgcgcccgcgcggcgaggaggagccg
cgcgtcagcctgccgggcgagatcgtgctcgaccgccgcgcgcaggacgacgaccagttc
tacgatttcgacagcaaatacatggatgcgcaggcgagccacgccgaagtgcccgcgcat
attcccgacgagctgatcgagcgcgtgcgcgcgacggcgttgaaggcgttcctggcgatt
gacggcaccggtctgagccgtgtcgacacctttgtgacgccgggcggcgacgtgctcgtc
aacgagatcaacacaatgcccgggttcacgtcgatttcgatgtaccccaaggcgtgggac
gccaccggcatcgcgtacaccgacctgatcaccacactgattcttggcgcattgcaccgc
tga

DBGET integrated database retrieval system