KEGG   Burkholderia pseudomallei MSHR146: BBN_2862Help
Entry
BBN_2862          CDS       T03024                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
bpsu00564  Glycerophospholipid metabolism
bpsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBN_2862
Enzymes [BR:bpsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BBN_2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AHG68185
LinkDB All DBs
Position
1:3307761..3309293
Genome map
AA seq 510 aa AA seqDB search
MTQQNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTSSSSTKLIHGGLRYLE
YKEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLIRIGLFLYDHLAKRELL
PGSRGIDMRRHPAGAPLVDSIKRGFVYSDGWVDDARLVVLNALDAQERGARILTRTKLVS
AERRDGQWHARLQRADGSTLDVRARAIANAAGPWVGEVLHGALGRGAQHSVRLVKGSHII
TPRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYRDDPSRVAIDRDETRYLCES
INRYFKRKISPADVCWTYSGVRPLLEDENADNPSAVTRDYRLELDDGEGAPLLSVFGGKI
TTFRKLAEEATDMLGGALGAARGAWTAGVPLPGGDIANARFAPFAEAFAKRHPWLPAALA
RRYARAYGTRAERVIGRARSLAELGAQLAPGLYEAELRYLRDVEWAGCADDVLWRRSKLG
LHVAPGTLEPVTAALDAWFGAAREAASAAH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaacagaatcgttacgatctgctcgtcgtcggcggcgggatcaacggcgcgggc
atcgcgcgcgatgcggccggccgcggcctgtcggtgctcctttgcgagcaggacgacctc
gcgtcgcacacctcctcttcgagcacgaagctgatccacggcgggttgcgctacctcgaa
tacaaggaattcgggctcgtgcgcaaggcgctgcaggaacgcgaaacgctgctgcgcgcg
gcgccgcacatcatgtggccgctgcgcttcgtgatgccgcacatgccgaacctgcgcccc
gcgtggctcatccggatcggcctcttcctgtacgaccatctcgcgaaacgcgagctgctg
ccgggctcgcgcggcatcgacatgcgccgccatccggcgggcgcgccgctcgtcgattcg
atcaagcgcggcttcgtctattcggacggctgggtcgacgatgcgcggctcgtcgtgctg
aacgcgctcgatgcgcaggagcgcggcgcgcgcatcctcacgcgcacgaagctcgtgtcg
gccgagcgccgcgacgggcaatggcatgcacgactgcaacgcgccgacggctcgacgctc
gacgtgcgggcgcgcgcgatcgcgaacgcggcgggcccgtgggtcggcgaagtgctgcac
ggcgcgctcggccgcggcgcgcagcatagcgtgcgcctcgtgaaaggcagccacatcatc
acgccgcgcctgttcgatcacgaccacgcatacatcttccagaatccggacaagcgcatc
atcttcgcgattccgtacgaacgcgacttcacgctgatcggcacgaccgacgtcgaatac
cgcgacgatccgtcgcgcgtcgcgatcgaccgcgacgaaacgcgctatctgtgcgagtcg
atcaaccgctatttcaagcgtaagatctcgcccgccgacgtatgctggacctactccggc
gtgcgcccgctgctcgaggacgagaacgcggacaacccgtccgccgtcacgcgcgactac
cgcctcgagctcgacgacggcgaaggcgcgccgctgctgtcggtgttcggcggcaagatc
acgacgtttcgcaagctcgccgaagaggcgaccgacatgctgggcggcgcgctcggcgcg
gcgcgcggcgcatggacggcgggggtgccgctgccgggcggcgacatcgcgaacgcgcgc
ttcgcgccgttcgccgaggcgttcgcgaaacgccacccgtggctgcccgccgcgctcgcg
cgccgctatgcgcgcgcgtacggcacgcgcgccgagcgcgtgatcgggcgggcccggtcg
ctcgccgagctcggcgcgcagctcgcgcccggcctctacgaagcggaattgcgttatctg
cgcgacgtcgaatgggcgggttgcgcggacgacgtgctgtggcggcgttcgaagctcggc
ctgcatgtcgcgccgggcacgctcgagcccgtgacggccgcgctcgacgcctggttcggc
gccgcgcgcgaagcggcgagcgccgcgcactga

DBGET integrated database retrieval system