KEGG   Burkholderia pseudomallei MSHR146: BBN_3124Help
Entry
BBN_3124          CDS       T03024                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
bpsu00550  Peptidoglycan biosynthesis
bpsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBN_3124
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpsu01002]
    BBN_3124
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpsu01011]
    BBN_3124
Enzymes [BR:bpsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BBN_3124
Peptidases [BR:bpsu01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BBN_3124
Peptidoglycan biosynthesis and degradation proteins [BR:bpsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BBN_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AHG68018
LinkDB All DBs
Position
1:complement(3620029..3621342)
Genome map
AA seq 437 aa AA seqDB search
MRLSSLGLTSLASSTAIAVAARNVALGIVLPAALVSTIAVAQAKPAAKAKHAAAPAAAAA
PTGAPATYVPGAVPPPGVNARSWVLVDASSNQVLASGNADERVEPASLTKLMTAYLVFEA
LDAKKITMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLVYGMIIQSGNDAAIALAEL
VGGSEAQFVNMMNAEAQRLGMKNTHFADVNGMPDPNHYTTAGDLAKLSTHLIRDYPDYYN
IFSVKEFTYNNIKQPNRNRLLWLDPTVDGLKTGHTQAAGYCLIASAKRALPGAADATRRL
VTVMMGETKESDRVQDSMKMLNYGYTAFDSVRLYKASQPIDTPRVYKGKSNNVQVGVKKD
QFITVPRGLADKVKPEVALNAPLIAPLADGQVVGSVKLVADGKTVAEFPVVALQPVPEAG
LLGRIWDSILLMFSKKK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgtcttccctcggcctcacgtcactcgcttcctccaccgccattgccgtcgcc
gcgcgtaacgtcgcgctcggcatcgtgctgcccgccgcgctcgtgtcgacgatcgccgtc
gcgcaggcgaagcccgccgccaaggcgaagcatgcggccgcgccggccgccgccgccgcg
ccgacgggcgcgcccgccacgtacgtgccgggcgccgtgccgccgccgggcgtgaacgcg
cgctcgtgggtgctcgtcgatgcgtcgagcaatcaggtgctcgcctccggcaacgccgac
gagcgtgtcgagcccgcgtcgctcacgaagctgatgacggcctacctcgtgttcgaggcg
ctcgacgcgaagaagatcacgatggagcagatcgtcacgccgagcgaggcggtgcgccgc
gtcggccgcgacgaatcgcggatgttcatcgaggcgaacaagcccgtgagcgtgcacgat
ctcgtctacgggatgatcatccagtcgggcaacgacgcggcgatcgcgctcgccgagctc
gtcggcggcagcgaagcgcagttcgtcaacatgatgaacgctgaagcgcagcgcctcggg
atgaagaacacgcacttcgccgacgtgaacggcatgcccgacccgaatcactacacgacg
gcgggcgacctcgcgaagctgtcgacgcatctgatccgcgactatccggattactacaac
atcttctcggtcaaggaattcacgtacaacaacatcaagcagccgaaccgcaaccggctg
ctgtggctcgatccgaccgtcgacggcctgaagaccggccacacgcaggcggcgggctac
tgcctgatcgcgtcggcgaagcgcgcgctgccgggcgcggcggacgcgacgcgccgcctc
gtcaccgtgatgatgggcgagaccaaggagagcgaccgcgtgcaggacagcatgaagatg
ctgaactacggctacaccgcgttcgattcggtgcgcctgtacaaggctagccaaccgatc
gacacgccgcgcgtctacaagggcaagagcaacaacgtgcaggtcggcgtgaagaaggac
cagttcatcaccgtgccgcgcggcctggcggacaaggtgaagccggaagtcgcgctgaac
gcgccgctcatcgcgccgctcgcggacggccaggtggtgggctcggtgaagctcgtcgcc
gacggcaagacggtggcggaattcccggtcgtcgcgctgcagccggtgccggaagcgggc
ctgctcggccgcatctgggattcgatcctgctgatgttcagcaaaaagaagtaa

DBGET integrated database retrieval system