KEGG   Burkholderia pseudomallei MSHR146: BBN_3141Help
Entry
BBN_3141          CDS       T03024                                 

Gene name
echA15
Definition
(GenBank) enoyl-CoA hydratase EchA15
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
bpsu00071  Fatty acid degradation
bpsu00280  Valine, leucine and isoleucine degradation
bpsu00281  Geraniol degradation
bpsu00310  Lysine degradation
bpsu00360  Phenylalanine metabolism
bpsu00362  Benzoate degradation
bpsu00380  Tryptophan metabolism
bpsu00410  beta-Alanine metabolism
bpsu00627  Aminobenzoate degradation
bpsu00640  Propanoate metabolism
bpsu00650  Butanoate metabolism
bpsu00903  Limonene and pinene degradation
bpsu00930  Caprolactam degradation
bpsu01100  Metabolic pathways
bpsu01110  Biosynthesis of secondary metabolites
bpsu01120  Microbial metabolism in diverse environments
bpsu01130  Biosynthesis of antibiotics
bpsu01212  Fatty acid metabolism
Module
bpsu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BBN_3141 (echA15)
   00650 Butanoate metabolism
    BBN_3141 (echA15)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBN_3141 (echA15)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBN_3141 (echA15)
   00310 Lysine degradation
    BBN_3141 (echA15)
   00360 Phenylalanine metabolism
    BBN_3141 (echA15)
   00380 Tryptophan metabolism
    BBN_3141 (echA15)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBN_3141 (echA15)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBN_3141 (echA15)
   00281 Geraniol degradation
    BBN_3141 (echA15)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBN_3141 (echA15)
   00627 Aminobenzoate degradation
    BBN_3141 (echA15)
   00930 Caprolactam degradation
    BBN_3141 (echA15)
Enzymes [BR:bpsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BBN_3141 (echA15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AHG68227
LinkDB All DBs
Position
1:complement(3638291..3639118)
Genome map
AA seq 275 aa AA seqDB search
MTDLALYAGYEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMHRELADIWRDVDRDPD
ARVAVIRGEGKGFSAGGDLALVERMADDHAVRERVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEP
VSGEEAERIGLVSLALDDHELLPKAYEIAERLAQGSQSAIRWTKYALNNWLRLAGPTFDA
SLALEFMGFSGPDVREGIRSLRERRAPDFTGGAPS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcgctctttatgccggctatgaagcgctgcgcatccagcgccggccgcac
ggcatcgtcgaaatcgtgatgagcggcgaaggcgcgaaccgcagcggcctcgcggtcgcg
agcgaggcgatgcaccgcgagctcgccgatatctggcgcgacgtcgaccgcgatcccgac
gcgcgcgtcgcggtgatccgcggcgaaggcaagggcttctcggcgggcggcgatctcgcg
ctcgtcgagcgcatggccgacgatcacgcggtgcgcgagcgcgtctggcgcgaagcgcgc
gatctcgtctacaacgtgatcaattgcagcaagccgatcgtgtcggcgatgcacgggccg
gccgtcggcgccgggctcgtcgccgggctgctcgccgacgtgtcgatcgccgcgaagcac
gcgcggatcatcgacgggcacacgcgtctcggcgtcgccgcgggcgatcacgcggcgatc
gtctggccgctgctctgcgggatggcgaaggcgaaataccacctgctcctctgcgagccc
gtgagcggcgaggaggccgagcgcatcgggctcgtgtcgctcgcgctcgacgatcacgag
ctgctgccgaaggcgtacgagatcgccgagcgcctcgcgcaaggctcgcaaagcgcgatc
cgctggaccaagtacgcgctcaacaactggctgcggctggccgggccgaccttcgacgcg
tcgctcgcgctcgaattcatgggtttttccgggccggacgtgcgcgaaggcattcgctcg
ctgcgcgagcgccgcgcgccggatttcacgggcggcgcgccgtcttga

DBGET integrated database retrieval system