KEGG   Burkholderia pseudomallei MSHR146: BBN_3645Help
Entry
BBN_3645          CDS       T03024                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBN_3645
Enzymes [BR:bpsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BBN_3645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AHG71047
LinkDB All DBs
Position
2:142869..144005
Genome map
AA seq 378 aa AA seqDB search
MPQTAEAPPQRAAERGETPALPATMRAVVCHGPRDYRLEQVPVPKPGPDEILTQVERVGI
CMGDIKTFRGAPSFWGDAVQPRYVKPPMIPGHEFVCRVVALGPGAERRGVKAGDRVISEQ
IVPCWSCRFCGHGQYWMCQKHDLYGFQNNVHGAMAEYMIFTKEAIVHRVPDSIPTDEAIL
IEPLSCSLHAADRANVGFDDVVVVAGAGTLGLGIIGAVRLRHPKQLIVLDMKPERAALAR
RMGADDVWNPAEENVIEKIRAITGGYGCDIYIEATGHHRAVGQGLAMLRKLGRFVEFSVF
NDEASVDWSIIGDRKELDVLGSHLGPYMYPRAIEFIASRRIDVRGIVTHTFPLSRFADAF
AVMERGEQSLKVVLDPRG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccacagacagccgaagcgccgccgcaacgcgcggccgagcgcggcgagacgcccgcg
ctgcccgccacgatgcgcgccgtggtttgccacggcccgcgagactaccgcctcgagcag
gtgccggtgccgaagccggggccggacgagatcctaacccaggtggagcgcgtgggcatc
tgcatgggcgacatcaagacgtttcgcggcgcgccgtcgttctggggcgacgcggtgcag
ccgcgctacgtgaagccgccgatgattcccggccacgaattcgtgtgccgcgtcgtcgcg
ctcggccccggcgccgagcggcgcggcgtgaaggcgggcgatcgcgtgatctccgagcag
atcgtgccgtgctggagctgccgcttctgcggccacggccagtactggatgtgccagaag
cacgatctgtacggattccagaacaacgtgcacggcgcgatggccgaatacatgatcttc
acgaaggaggcgatcgtgcaccgcgtgcccgattcgatcccgaccgacgaggcgatcctg
atcgagccgctgtcgtgctcgctgcacgcggccgatcgcgcgaacgtcggcttcgacgac
gtggtcgtcgtcgccggcgcgggcacgctcgggctcggcatcatcggcgcggtgcggctg
cgccatccgaagcagctgatcgtgctcgacatgaagcccgagcgcgcggcgctcgcgcgc
cggatgggcgcggacgacgtgtggaacccggccgaggagaacgtgatcgagaagatccgc
gcgatcacgggcggctacggctgcgatatctacatcgaggcgaccggccaccatcgcgcg
gtaggccaggggctcgcgatgctgcgcaagctcgggcgcttcgtcgagttcagcgtgttc
aacgacgaagcgagcgtcgactggtcgatcatcggcgatcgcaaggagctcgacgtgctc
ggctcgcatctcggcccgtacatgtacccgcgcgcgatcgagttcatcgcatcgcgcagg
atcgacgtgcgcggcatcgtcacgcacacgttcccgctgtcgcgcttcgccgacgcgttc
gccgtgatggagcgcggcgagcaatcgttgaaggtcgttctggatccgcgaggttaa

DBGET integrated database retrieval system