KEGG   Burkholderia pseudomallei MSHR146: BBN_3899Help
Entry
BBN_3899          CDS       T03024                                 

Definition
(GenBank) transglutaminase-like superfamily protein
Organism
bpsu  Burkholderia pseudomallei MSHR146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2126 Bact_transglu_N Transglut_core
Motif
Other DBs
NCBI-ProteinID: AHG70480
LinkDB All DBs
Position
2:466409..469831
Genome map
AA seq 1140 aa AA seqDB search
MSIHVALHHVTRYRYDRLVRLGPQIVRLRPAPHCRTPVLSYSMKVEPAQHFVNWQQDPFA
NYMARLVFPERTRTLEIAIDLVAEMSVYNPFDFFLEEHAQTFPFDYGDALRRELAPYLAC
DSATGACDAFRSYIESIDRAPAGTVDFLVALNRRLQHDIRYVVRLEPGVQTPGQTLALAS
GSCRDSGWLLVQLCRHLGLAARFVSGYLIQLTPDVKSLDGPSGAEADFTDLHAWCEVYLP
GAGWIGFDPTSGLLAGEGHIPLAATPQPTSAAPVEGLVDECEVQFEHEMRVTRIYESPRV
TKPYTDEAWQRVLRLGAQVDAALNAGDVRLTQGGEPTFVSIDDRDGAEWNTDALGPTKRG
HATSLVQKLRAEYGVGGFLHFGQGKWYPGEQLPRWALSIFWRADGQPVWRDPARFADERE
PSAYTSADAERFIRALAARLGLAGDYVTPGYEDVWYYLWRERRLPVNVDPFDARLDDELE
RARLRKVFSQQLDSVIGYVLPLKPLAPNPALAGPRWETGPWFFRDERMYLVPGDSPMGYR
LPLDSLPWASRGDYPYLVERDPFAPRDALPDADALRAHHVGGGFGAPRDPGAAARDADAP
ARPVMQARAGECAFARPAGEADAARFPQRFESAGWITRTALCVEARGGVLYVFMPPIAAL
EDYLDLLAAIELTAESLDAKLVLEGYPPPRDARLKMLQVTPDPGVIEVNIHPAHDFDELV
QHTEFLYDAAYRSRLSSEKFMVDGRHVGTGGGNHFVLGGATPADSPFLRRPDLLASLIAY
WHNHPSLSYLFSGLFIGPTSQAPRVDEARDDQVYELDIAFAELRRNTLRAGEDMPPWLVD
RVLRNLLIDVTGNTHRSEFCIDKLYSPDSATGRLGLLELRAFEMPPHARMSIVQQLLLRA
LIARFWRAPYTAPLARWGTALHDRFLLPSFVRMDFDDVLTELREAGFGFDAAWFAPHFEF
RFPLFGQIAARGVALALRGALEPWHVMGEEGAIGGTVRYVDSSLERLEVRVSGLNDSRYV
VTVNGRALPLQPTGTAGEYVAGVRYKAWAPPSALHPTIGVHAPLTFDIVDTWMRRSLGGC
RYHVAHPGGRHYDTFPVNAYEAESRRLARFVSMGHTPGAMTVEPAAPSREFPFTLDLRHG
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atgtccattcacgtcgcgcttcaccacgttacccgctaccgctacgaccggctcgtccgg
ctcggcccgcagatcgtgcgcctgcgccccgcgccgcattgccgcacgcctgtcctgtcg
tactcgatgaaggtcgagcccgcgcagcacttcgtcaactggcagcaggatccgttcgcg
aactacatggcgcggctcgtgtttcccgagcgcacgcgcacgctcgagatcgcgatcgac
ctcgtcgccgagatgtcggtctacaacccattcgattttttcctggaagagcacgcgcag
acctttccgttcgactatggcgacgcactgcgccgcgagctcgcgccgtatctcgcgtgc
gattccgccacgggcgcctgcgacgcgtttcgttcgtatatcgaatcgatcgatcgcgcg
ccggcgggcaccgtcgactttctcgtcgcgctgaaccggcggctgcagcacgacatccgc
tacgtcgtgcggctcgagccgggcgtgcagacacccgggcagacgcttgcgctcgcatcg
ggctcgtgccgcgacagcggctggctgctcgtgcagctgtgccgccacctcggcctcgcc
gcacgcttcgtgtccggctatctgatccagttgacgcccgacgtgaagtcgctcgacggc
ccgagcggcgccgaggccgacttcaccgatctgcacgcgtggtgcgaagtgtatctgccg
ggcgcgggctggatcggtttcgatccgacatcggggctgctcgcgggcgaagggcatatt
ccgcttgccgcgacgccgcagccgacgagcgccgcgcccgtcgaggggctcgtcgacgaa
tgcgaggtccagttcgagcacgagatgcgcgtgacgcgaatctacgaatcgccgcgcgtg
acgaagccgtatacggacgaagcgtggcagcgcgtgctgcggctcggcgcgcaggtcgac
gccgctttgaacgcgggcgacgtgcgcctcacgcagggcggcgagccgacgttcgtgtcg
atcgacgatcgcgacggcgcggaatggaacaccgatgcgctggggccgacgaagcgcggc
catgcgacgtcgctcgtgcagaagctgcgagcggagtacggcgtgggcggcttcctgcac
ttcggccagggcaagtggtatccgggcgagcaactgccgcgctgggcactgtcgatattc
tggcgcgcggacggccagcccgtctggcgcgatccggcgcgcttcgccgacgagcgcgaa
ccgtccgcgtacacgagcgccgacgccgagcgcttcattcgcgcgctcgcggcgcgtctc
gggctcgcgggcgattacgtgacgccgggctacgaagacgtctggtattacctgtggcgc
gagcggcggctacccgtgaacgtcgatccgttcgacgcgcggctcgacgacgagctcgag
cgtgcgcgtctgcgcaaggtgttctcgcagcagttggacagcgtgatcggctacgtgctg
ccgctcaagccgctcgcgccgaatccggcgctcgcggggccgcgctgggagacgggcccg
tggttcttccgcgatgagcggatgtatctcgtgccgggcgattcgccgatgggctatcgc
ctgccgctcgattcgctgccgtgggcgagccgcggcgactatccatatctcgtcgagcgt
gatccgttcgcgccgcgcgacgcgttgcccgatgcggatgcgctgcgcgcgcaccatgtc
ggcggcggcttcggcgcacctcgcgatccgggcgcggcggcgcgcgacgccgacgcgccc
gcgcggcccgtgatgcaggcgcgcgccggcgaatgcgcgttcgcgcggccggcgggcgag
gccgatgccgcgcgcttcccgcagcgcttcgagtccgccgggtggatcacgcgcaccgcg
ctgtgcgtcgaggcacgcggcggcgtgctctacgtgttcatgccgccgatcgccgcgctc
gaagactatctcgacctgttggccgcgatcgagctgaccgccgaatcgctcgacgcgaag
ctcgtgctcgaaggctacccgccgccgcgcgacgcgcggctgaagatgctgcaggtgaca
cccgatcccggtgtgatcgaagtaaacatccatcccgcgcacgatttcgacgagctcgtt
cagcacaccgaattcctgtacgacgccgcgtatcgatcgcggctgtcgagcgagaagttc
atggtcgacggccggcatgtcggcacgggcggcggcaatcacttcgtgctcggcggcgcg
acgcccgccgacagcccgttcctgcgccgtcccgatctgctcgcgagcctgatcgcgtat
tggcacaatcatccgtcgctgtcctacctgttctcggggctcttcatcggcccgacgagc
caggcgccgcgcgtcgacgaggcgcgcgacgatcaggtctacgaactcgatatcgcgttc
gccgagcttcgccgcaacacgctgcgcgcgggcgaggacatgccgccgtggctcgtcgat
cgcgtgctgcgcaatctgctgatcgacgtgacgggcaacacgcatcgcagcgaattctgc
atcgacaagctctattcgccggattcggcgacggggcgcctcggcctgctcgagctgcgc
gcgttcgaaatgccgccgcacgcgcgaatgagcatcgtccagcaattgctgttgcgcgcg
ctgatcgcgcgcttctggcgcgcgccgtacacggcgccgctcgcgcgctggggcaccgcg
ctgcacgatcgcttcctgctgccgagcttcgtcaggatggatttcgacgacgtgctgacc
gaactgcgcgaagcgggcttcgggttcgacgcggcgtggttcgcgccgcacttcgaattc
cgttttccgctgttcgggcagatcgccgcgcgcggcgtcgcgctcgcgctgcgcggcgcg
ctcgagccgtggcacgtgatgggcgaggagggggcgatcggcggcaccgtgcgctacgtc
gattcgtcgctcgagcggctcgaagtccgggtgagcgggctgaacgacagccgctacgtc
gtgaccgtcaacggccgcgcgctgccgctgcagccgacgggcaccgccggcgagtacgtc
gcgggcgtccgctacaaggcgtgggcgccgccttcggcgctgcatccgacgatcggcgta
cacgcgccgctcacgttcgacatcgtcgatacatggatgcggcgctcgctcggcggctgc
cggtatcacgtcgcgcatccgggcggccgccactacgacacgttccccgtgaacgcttac
gaagccgagagccggcggctcgcgcgcttcgtgtcgatggggcacacgccgggcgcgatg
acggtcgagccggccgcgccgagccgcgaatttccgttcacgctggatttgcggcatggg
tga

DBGET integrated database retrieval system