KEGG   Burkholderia pseudomallei MSHR146: BBN_6057Help
Entry
BBN_6057          CDS       T03024                                 

Gene name
cga
Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
bpsu00500  Starch and sucrose metabolism
bpsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBN_6057 (cga)
Enzymes [BR:bpsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BBN_6057 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AHG71344
LinkDB All DBs
Position
2:complement(3227951..3230596)
Genome map
AA seq 881 aa AA seqDB search
MSARHFGFRQAVLVGSLAALAGAAALPANTSAAEAFGSPGAAPVRGPAAKSFLGTAVNGA
SRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAAQTDTRTMSW
QVTTGNSSHNWQIRKIVFADPNHNAIVQRVTFTALNGRKVGDFNLYMLSKPYLDNAGANN
TAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTADK
TMDWTFASATNGNVAQMGWLDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGSDLAGE
QQQYDTGWHNYAAGLSSQNGAADDGYYLAAMSLKTMQDKSNGAMIAGIGTPWGETQGDAN
AGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNAPGCAQGYS
RVGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPW
TYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAADYWQENVAAWTYT
SSGAFGNGSYYIRINPAGRAGTGTDRASFAPTAGPDTPQTLSVKNGGGSHDARRVVDGGF
FELVRMGVKRATDPTIANTISVYDSVLGQTLNVANAPALSPNAWFRYNFDGYGEHNDGGD
FDGTGAGRLWPIFTAERGMVEIARQGSGGAGSAYFSTLKQLTTPEGFVPEQVWSNSTTLP
DGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYNNCAAPP
QSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPASYPVWRNTVNLPAAQA
IQYKYYRKNADGSVTWENRSGNRQLQTPASGTLALNDQVSW
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaggcacttcggattcaggcaggcggtgctggtgggcagtctggccgcgctc
gcgggcgcggcggccctaccggcgaatacttcggctgccgaagcattcggctcgcccggc
gccgcgcccgtgcggggcccggcggccaagtcgttcctcggcacggcggtcaacggcgca
tcgcgggtgtacttcaccggttatcgcggcatcctgtccgaggtctactacccggtcctc
gatacgcccgagtccgtcgacctgcagttcctcgtcggcgacgccggcaagaccttcgtc
gacgaagaaaagcagcaggcctactcggccgcgcaaacggacacgcgcacgatgagctgg
caggtgacgaccggcaacagttcgcacaactggcaaattcgcaagatcgtcttcgccgat
ccgaaccacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcaacggccgcaaggtg
ggcgacttcaatctctacatgctgtccaagccgtacctcgacaacgccggcgccaacaat
accgcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagccgc
tattcggcgctcgtcgcgagccgcccgtggaaggtggtcaacggcgtgggcatgacgtcg
aacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgacaag
acgatggactggaccttcgcgtccgcgaccaacggcaacgtcgcgcagatgggctggctc
gacctcggcgatccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggcggc
acgcaggaccaggcgctcggcgacgcgaacacggtgctcggcagcgatctcgccggcgaa
cagcagcagtacgacaccgggtggcataactacgcggcgggcctgtcgtcgcagaacggc
gccgcggacgacggctactacctggccgcgatgtcgctcaagacgatgcaggacaagagc
aacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcgaac
gcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctgacg
acggcgggcgacacgtcgagcgcgacgagcgtcgtcaactacctgttcaacacgctgcag
cagacgaccgattgcggcaccgccgaatacaacgcgcccggctgcgcgcagggctacagc
cgcgtcgggcgctttccgcagaacgcatgggtgaacggctggccgtactggcagggcacg
cagatggacgagcaggcgatgccgatcatcctcgcgtggcgcctcggcccgagcgtgttc
aatccgctgtggccgaagatcaagctcaccgccgactacatcgtcaataccggcccctgg
acgtaccaggagcgctgggaggagaacgccggctattcgccgtcgacgatcgccgccgag
atcgcgggcctcgtcacggcggccgatatcgcgacgcaaaacggcgacacggcgagcgcc
gcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtacacg
tcgagcggcgcgttcggcaacggcagctactacatccggatcaatccggcgggccgcgcg
ggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcagacg
ctgagcgtgaagaacggcggcggcagccacgacgcgcggcgcgtcgtcgacggcggcttc
ttcgagctcgtccggatgggggtcaagcgcgcgaccgatccgacgatcgccaacacgatc
tcggtctacgacagcgtgctcggccagacgctgaacgtcgcgaacgcgccggcgctgtcg
ccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaacgacggcggcgat
ttcgacggcaccggcgccggccggctgtggccgatcttcaccgccgagcgcggcatggtc
gagatcgcgcgccagggcagcggcggcgcgggcagcgcgtacttctcgacgctcaagcaa
ttgacgacgcccgagggcttcgtgccggagcaggtgtggtcgaattcgacgacgctgccc
gacggctgggcggtgacgacgcccgcgggctacacgccgggccagccgaccaaatcgatg
gcgccgctcaactgggcgatgggcgaatacatcagcctgctcgcatcgatccaggcgggg
cgcatcgtcgacgtgccgtcggtggtctgcgcgcgctacaacaactgcgccgcgccgccg
caaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccagcag
atgtacgtgacaggcaacgtcgccgcgctcggcaactggaacaccgatctcggcattccg
gtcgatccggccagctacccggtgtggcgcaacaccgtcaacctgccggccgctcaggcg
atccagtacaagtactaccggaagaacgcggacggcagcgtaacgtgggagaaccgttcc
ggcaaccgccagcttcagacgcccgcgagcggcacgttggcgctgaacgatcaggtgagc
tggtga

DBGET integrated database retrieval system