KEGG   Bordetella petrii: Bpet0899
Entry
Bpet0899          CDS       T00637                                 

Definition
(GenBank) putative secreted protein
Organism
bpt  Bordetella petrii
SSDB
Other DBs
NCBI-ProteinID: CAP41231
UniProt: A9I8E0
LinkDB
Position
993879..995318
AA seq 479 aa
MPRLSVFTLYGVMTSRNLPRKRVSRPLSAALLAGNMALGACATLEPPAASPATEAPAETP
QAPPPARHAWNEIERAAREGISVLAPAQPLPVAPVARPESRELDLDPMPCQLTPAEGLTD
SSLRPVASLPDAAQRPPGPDATGTLDAPVDAGPEAAPLPIQCANLFPDVAPAPRQEYAFG
LETRDPVPHGSVMVVTGMAQPPNPWFSSVGAQQGFSYGGGRWVYHASAGPTVALGNLTAN
APIWGSAVPIGGLQIADWAGGTQHVPQGRLAYSSTVGVLNYTDMAARSGAIDYGVTAGSG
TLRYGLTPELTLESQMQSAPDLSTRGLGSTYSAGDLGTFQAGATQSSFDDINAWRYRFGY
NVNLFESVSLAVTNEQIGAGFGDLAQYRNGVAAAPQMRNTLAAGVPIMGWGTLTGTYSGL
RQSGEPIEQRFGLQHSMLIAPSVRLAVGADRDVVTGDYEMRAGVTMPVDAFMRGRWLPW
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgcctcgcctttcggtctttacactgtacggtgtcatgacctcgcgcaatttgcctcgc
aaacgggtctcccgcccgctgtcggccgccttgcttgccggcaacatggccctgggcgcc
tgcgctacgctcgaacccccggccgccagccccgccaccgaggcgccagccgaaaccccc
caggcgccgccgccggcccgccacgcctggaacgagatcgagcgggcggcgcgcgagggc
atttcggtgctggcgccggcgcagcccttgccggtggcaccggttgcccggcccgagtcg
cgcgagctcgacctcgatcccatgccctgccagctgacaccggccgaaggcctgaccgat
tcgtcgttgcgtcccgtcgcgagcctgcccgacgccgcgcagcggccgcccggcccggac
gctaccggcacgttagatgccccggtggatgccggcccggaggccgcgccgctgcccatt
caatgcgccaacctgtttcccgatgtggccccggcgccccggcaggaatacgccttcggc
ctggaaacccgcgacccggtgccgcatggctcggtcatggtggtgaccgggatggcgcag
cctcccaatccctggttttcctccgtcggcgcgcaacagggcttttcgtacggcggcggg
cgctgggtctatcacgcctccgccggtccgacagtggcgctgggcaacctgaccgccaac
gcgcccatctggggcagtgccgtgcccatcggcggattgcagatcgccgattgggccggc
gggacacaacacgtgccgcaagggcgcctggcttattcgtcgacggtgggcgtgttgaac
tacaccgacatggcggcccggtccggcgccatcgactatggcgtcacggccggcagcggc
accctgcgctacggcctgacccccgagctgaccctggaaagccagatgcagagcgcgccc
gacctgtccacgcggggcctgggcagtacgtattcggcgggcgacctgggcacgttccag
gccggcgccacgcagagcagcttcgatgacatcaacgcctggcgctatcgcttcggctac
aacgtcaacctgttcgagtccgtcagcctggcggtcaccaacgaacagatcggcgcgggg
ttcggcgacctggcccagtatcgcaatggcgtggcggccgcgccgcagatgcgcaacacc
ctggcggccggcgtgccgatcatgggctggggcacgcttaccggcacctacagcgggctg
cgccagtccggcgagcccatcgagcagcgcttcgggctgcagcacagcatgctgatcgcg
cccagcgtgcgcctggcggtcggcgccgatcgcgacgtggtgacgggcgactatgaaatg
cgcgccggcgtcaccatgccggtggacgccttcatgcgcggccgctggctgccgtggtag

DBGET integrated database retrieval system