KEGG   Bordetella petrii: Bpet1066
Entry
Bpet1066          CDS       T00637                                 

Definition
(GenBank) putative secreted protein
Organism
bpt  Bordetella petrii
SSDB
Other DBs
NCBI-ProteinID: CAP41398
UniProt: A9IB96
LinkDB
Position
1133464..1134063
AA seq 199 aa
MCPSPPWFHHPERRLLAGFLGLLWSVLAGGCATTPTPAAPDTTQEVSAAPEVSSPEFIPV
VRYGRYTLVEMAPTAAQRDLLMQVIDVAMPEDARTTVGDGLRHVLKRSGYQLCETAHAVI
ELYALPLPAAHLHLGPMTLRDALLTLAGPAWELHADDRARQICFERPGNSMTARNAPAPL
ATDAVQTFPLAPAVSGDQP
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtgcccatcaccaccctggtttcaccatcccgaacgccgcctgctggcgggttttctc
ggcctgctttggtcggtgctggcgggcggctgcgcgacgaccccaacgcccgccgcaccc
gatacgacccaagaggtatcggctgcgccggaagtcagctcacccgagttcattcccgtc
gtgcgctatggccgctacaccctcgtggagatggcgcccacagcggcacagcgcgacctg
ctgatgcaggtcatcgacgtggccatgcccgaggatgcccgcaccacggtcggggatggg
ctgcggcacgttctcaaacgcagcggctaccagctttgcgagacggcgcatgcggtgatc
gagctgtacgcgctgccgctgccggcggcgcacctgcatctcggccccatgaccttgcgc
gacgcgctgctcacgttggctggcccagcctgggagctgcacgcggatgaccgcgcacgg
caaatctgctttgagcggcccggcaacagcatgaccgcccgcaacgcacccgcgcccctc
gcaaccgatgcggtgcagacgttcccgctggcacctgcggtttcaggagaccagccatga

DBGET integrated database retrieval system