KEGG   Bordetella petrii: Bpet1073
Entry
Bpet1073          CDS       T00637                                 

Definition
(GenBank) putative membrane protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: CAP41405
UniProt: A9IBA8
LinkDB
Position
1139615..1139998
AA seq 127 aa
MVASIWLRAAHRGVPTFLVTALVLGQSPMALAESPAQRQELVAALRQLDALERTVADSAA
HTPITPGERYHFDYPRLLADLARVRAGIQAHLTPSRAQPRDPSELASDYRTERTASPPPK
TTAEGKQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atggtggcttcgatctggctgcgcgccgcgcatcgcggcgtgcccacttttctcgtgacg
gccctcgtgctgggccagtccccgatggcgttggccgaatccccggcgcagcgccaggaa
ctggtcgccgcgctgcgccagctcgacgcgctggagcgcaccgtcgcggacagcgccgcg
catacccccatcacgcctggcgagcgctaccacttcgactacccgaggctgttggctgac
ctggcgcgcgtgcgcgccggcatccaggcccatctcactccgtcgcgtgcccagccacgc
gacccctccgaacttgccagcgactaccgcaccgagcggaccgcttcgccaccgccgaag
acgactgcggagggcaagcaatga

DBGET integrated database retrieval system