KEGG   Bordetella petrii: Bpet1478
Entry
Bpet1478          CDS       T00637                                 

Definition
(GenBank) putative secreted protein
Organism
bpt  Bordetella petrii
SSDB
Other DBs
NCBI-ProteinID: CAP41813
UniProt: A9IFX3
LinkDB
Position
1530709..1531308
AA seq 199 aa
MCPSPPWFHHPERRLLAGVLGLLWSVLAAGCATTTAPPPPDAFEEVLAAPESEAPEYIPV
VRYGRYTLVELAPTAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYSLCQTAHAVI
ELYALPLPAAHLHLGPMTLRDALLTLAGPAWELHVDDRARQICFERPADSAAIEPASESP
AAEAVQTFPLEPSVSGGQP
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtgcccctctccaccttggtttcaccatcccgaacgccgcctgctggcgggagtcctc
ggcctgctctggtcggtgctggctgctggctgcgcgacgacgactgcgccgcccccgccc
gatgccttcgaggaagtcttggccgcgccggaatccgaggcgcccgagtacatccccgtc
gtgcgctacggtcgctacacgctggtcgagctggcacccacggcggcgcagcgggacctg
ctgttgcagaccatcgacgtgtccatgcccgaagatgcccgtgccaccgtcggcgatggg
ctgcggcatgtgctcaagcgcagcggttacagcctatgccagacggcgcacgcggtgatc
gagctgtacgcgctgccgctgccggcggcgcacttgcacctcggccccatgaccttgcgc
gatgcgctgctcacactggctggccccgcctgggaactgcacgtggatgatcgcgcacgg
cagatttgcttcgaacggcctgccgacagcgcggccatcgaacccgcatccgagtcaccc
gccgccgaggcggtgcagacgttcccgctggagccttctgtttcgggaggccagccatga

DBGET integrated database retrieval system