KEGG   Bordetella petrii: Bpet1540Help
Entry
Bpet1540          CDS       T00637                                 

Definition
(GenBank) probable Ring hydroxylating alpha subunit
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
bpt  Bordetella petrii
Pathway
bpt00627  Aminobenzoate degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bpet1540
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     Bpet1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A DUF4686
Motif
Other DBs
NCBI-ProteinID: CAP41879
UniProt: A9IG99
LinkDB All DBs
Position
1588469..1589731
Genome map
AA seq 420 aa AA seqDB search
MSEMVAKPSAHAERTVSFLQPNGSEVPFRVFSSQEVYDREQERIFRGATWSFLGLEAEIP
NVYDFKSTFIGDTPVVVTRTPDGLSCWVNRCAHRGAQVCRELRGNARSHACVYHQWGYSA
KGDLLGVPFRRGQNGMAGMPADFKTEEHGLQQVRVASYRGLVFGTFRQDTPSLEDYIGPM
MRPWIDRIFHKPVVYLGCTRQYSKSNWKLYLENVKDGYHASLLHLFHTTFNIYRVGMKVR
QMADVGGLHSLLTSTKPEVDTNTAAAYEAQKVRTMNNKLVLEDPTLLGQIQEYEEITTNN
IQAILPQLVIQQIHNTLAARQLLPKGPNNFELIFHFFGYEDDTPELRELRLLQANLVGPA
GYISMEDTEATELVQRATRMDPDSHSYIAMAQDVPEETDSSITEYMIRRFWTSYQALMGY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaatggtcgccaagccgtctgcgcatgccgagcgcacagtgtcttttttacag
cccaatggttccgaagtgccttttcgggtctttagttcgcaggaagtgtatgaccgcgag
caggagcgaatctttcgcggtgcgacctggtccttcctcggcttggaggcggagatcccg
aacgtgtacgacttcaagagcactttcatcggcgacacgccggtagtcgtgacgcgcacg
cccgatgggttgtcatgctgggtcaatcgatgcgcgcaccgcggcgcgcaggtctgccgc
gagctgcgtggcaacgcccgctcccatgcgtgcgtgtatcaccagtggggctattcggca
aagggcgatctgctgggcgtcccgttccgccggggccagaatggaatggccggcatgccg
gccgacttcaagaccgaagagcatggtctgcagcaggtgcgcgtcgccagctaccgtggg
ctggtgttcggcacctttcgccaagacacgccgtcgctggaggactacatcggtccgatg
atgcgcccctggattgaccgcatctttcacaagccggtggtctatctcggctgcacgcgg
cagtattccaaatccaactggaagctgtacctggaaaacgtcaaggatggctaccacgcg
agccttctgcatctgtttcacacaaccttcaacatctaccgcgtggggatgaaggtgcgc
cagatggcggatgtgggcggcctgcacagcctcttgacctcgaccaagcctgaagtcgat
accaataccgctgcggcctacgaggcccagaaggtgcgcacgatgaacaacaagctcgtg
ctggaagacccaaccctgctcgggcagatccaagagtacgaagaaatcaccaccaacaac
atccaggccatcctcccccaattggtgatccagcagatccacaacacgctggcggcgcgc
cagttgctccccaagggtccgaacaacttcgagctgatctttcatttcttcggctacgag
gacgataccccggagttgcgcgaactgcgcctcctccaggccaacctcgtcggtcccgca
ggctacatctcgatggaggacacggaggccacagaactggtgcagcgcgccacgcgcatg
gatccggacagccattcgtacatcgctatggcccaggacgttccagaggagacggactct
tcgatcacggaatacatgatccgacgcttctggaccagctaccaggcattgatggggtac
tga

DBGET integrated database retrieval system