KEGG   Bordetella petrii: Bpet2589Help
Entry
Bpet2589          CDS       T00637                                 

Gene name
glpA
Definition
(GenBank) glpA
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpt  Bordetella petrii
Pathway
bpt00564  Glycerophospholipid metabolism
bpt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bpet2589 (glpA)
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Bpet2589 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 GIDA Pyr_redox_2 FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CAP42931
UniProt: A9IPD1
LinkDB All DBs
Position
2709936..2711534
Genome map
AA seq 532 aa AA seqDB search
MNPNPASLPVPGRAALLETLNDNAAWDVIVIGGGATGLGTAVDAASRGYRTLLLEAADFA
KGTSSKATKLVHGGVRYLAQGNIALVREALHERGLLNRNAPHLVWPLGFVVPAYGLFDQP
FYGIGLKMYDMLAGKLNLSPSRWLSRAETLAQAATVAPSVAGRGLRGGVLYYDGQFDDAR
LAMALMRTLFDLGGTAVNYVRASGLTRNEKGAIDGVIAQDVLGGGEVTLRARCVVNAAGV
WVDSVRRMDDAQAQTMVAPSQGVHLVLPREFLPGDKAILIPKTDDGRVLFVVPWNGHTLV
GTTDTPRADLPLDPPATATEVDFILQTAARYLSRKPTRADVTSVWAGLRPLVKATGETKT
LSREHTIVVSRAGLVTVTGGKWTTYRKMAQDVVDTAIQHQLLPQAGCRTADLPLHGAGGA
PGPDAPAPGTPDSYYGSDLPTLRALPGSEHILVKASGLTEAHVRFAARHELARSAEDVLA
RRNRALFLDSQAALLAAPEVARILAEELGHDAAWQRATVEDFTRTAAHYRLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccaaccccgcatccctgcctgtgcccggccgcgccgccctgctcgaaacgctg
aacgacaacgccgcctgggacgtcatcgtgatcggcggcggcgccaccggactgggcacc
gcggtcgatgccgcatcgcgcggctaccgcacgcttttgcttgaagccgccgatttcgcc
aaaggcacgtccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcccag
ggcaacatcgcgctggtgcgcgaagccctgcacgagcgcgggctgcttaaccgcaacgcg
ccgcacctggtctggccgctgggtttcgtggtgccggcctacggcctgttcgaccagccc
ttctacggcatcggcctcaagatgtacgacatgctggcgggcaagctcaatctgtcgccc
agccgctggctgtcgcgcgccgaaacactggcccaggccgccacggtggccccgtcggta
gccgggcgcggcctgcgcggcggcgtgctgtactacgacggccagttcgacgacgcgcgc
ctggccatggccctgatgcgcaccctgttcgacctgggcggcaccgccgtcaattacgtg
cgcgccagcggccttacccgcaacgagaaaggcgccatcgacggcgtgattgcgcaagac
gtgctgggcggcggcgaagtcacgctgcgcgcgcgctgcgtggtcaatgccgcgggcgtt
tgggtggacagcgtgcgccgcatggacgacgcccaggcgcagaccatggtggcgcccagc
cagggcgtgcacctggttctgccgcgcgaattcctgcccggcgacaaggccattcttatt
cccaagaccgacgacggccgcgtgctgttcgtggtgccctggaatggccacaccctcgtc
ggcaccaccgacaccccgcgcgccgacctgccgctggatccgcccgccaccgccaccgag
gtcgatttcatcctgcagaccgccgcgcgctatctcagccgcaaacccacccgcgccgac
gtcaccagcgtctgggcggggctgcgccccctggtcaaggccaccggcgaaaccaaaacc
ttgtcgcgcgagcacaccatcgtggtgtcgcgcgccggcctggtcaccgtcaccggcggc
aaatggaccacctaccgcaaaatggcgcaggacgtggtcgataccgccatccagcaccag
ctgctgccgcaggcgggctgccgcaccgccgacctgccgctgcatggcgcgggcggcgcg
cccgggcccgacgcaccggcgcccggcacgcccgacagctactacggcagcgacctgccg
acgttgcgcgccctgcccggcagcgaacacatcctggtcaaggccagcgggctgaccgaa
gcccacgtgcgattcgccgcgcgccatgaactggcgcgcagcgccgaagacgtgctggcg
cggcgcaaccgcgcgctgttcctggacagccaggcggccctgctggccgcgcccgaagtc
gcgcgcatcctggccgaagagctgggtcatgacgcggcctggcaacgcgccacggtcgaa
gacttcacccgcaccgccgcgcattaccggctcgattaa

DBGET integrated database retrieval system