KEGG   Bordetella petrii: Bpet4714Help
Entry
Bpet4714          CDS       T00637                                 

Definition
(GenBank) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpt  Bordetella petrii
Pathway
bpt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bpet4714
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpt02000]
    Bpet4714
Enzymes [BR:bpt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bpet4714
Transporters [BR:bpt02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bpet4714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4 MRP_L53 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CAP45066
UniProt: A9IFM7
LinkDB All DBs
Position
4976341..4976952
Genome map
AA seq 203 aa AA seqDB search
MKLYYHPLSGHAHRARLFLSLIGQPVELVEVDLPRRAHKQPEFLKLNAFGQVPVLVDGDI
AVADSNAILVYLSKKFGKTDWLPETPAQAAAVQRWLSVAAGDIAFGPAAARMVTVFGAPL
DAEAAIARAHVVLKRMDDALAAGPWIAGPQPTIADVALYSYTARAPEGCVDLQGYTHVRQ
WLARVEALPGFVEFQRTPVGLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactatcacccgctctcgggccatgcgcaccgcgcccgcctgttcttgtcg
ctgatcggccagcccgtcgagctggtcgaggtggacctgcccaggcgcgcccataaacag
cccgagttcctgaagctcaatgccttcggccaagtgccggtgctggtggatggcgatatt
gctgtggccgactcgaacgccatcctggtctatctgagcaagaaattcggcaagaccgac
tggctgcccgaaacgcccgcgcaggccgcggccgtgcagcgctggctttcggtagcggct
ggagacatcgccttcgggccggccgcggcgcggatggtgactgtattcggcgcgcccctg
gacgccgaggcggcgattgcccgcgcccatgtggtgctcaagcgcatggacgatgcgctg
gccgccggcccttggatcgctggcccccagcccactattgccgacgtggcgctgtacagc
tacacggcgcgcgcgccggaaggttgcgtcgacttgcagggctatacccacgtgcggcaa
tggctggcccgcgtagaggccctgcccgggttcgtggaattccagcgcacccccgtcggc
ctggcagcctga

DBGET integrated database retrieval system