KEGG   Bacillus pumilus SAFR-032: BPUM_0437Help
Entry
BPUM_0437         CDS       T00599                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00473  D-Alanine metabolism
bpu01100  Metabolic pathways
bpu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BPUM_0437
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BPUM_0437
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpu01011]
    BPUM_0437
Enzymes [BR:bpu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BPUM_0437
Peptidoglycan biosynthesis and degradation proteins [BR:bpu01011]
 Precursor biosynthesis
  Racemase
   BPUM_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C BTB_2 DUF1796
Motif
Other DBs
NCBI-ProteinID: ABV61132
UniProt: A8FA65
LinkDB All DBs
Position
503764..504942
Genome map
AA seq 392 aa AA seqDB search
MDTNAFYRDTWAEINLSAIKHNVSHMKDHIGQSVQLMAVVKANAYGHGDIEVASAALKAG
ADILAVAFLDEAVSLRNKGIKAPILVLGAVPTEYVKVAVRYNVIMTAYSIDWLKDVINMM
EGQMGQPIRFHLKIDSGMNRLGVKTIEQVNEVKKLVDEHSYLQLEGVFTHFATADEKDEA
YFDRQVDTFQTLLEPLHTDKLLIHCANSAAGLRFKDVLFNMVRFGISMYGLSPSEEIKDE
LPFKLEEAMSLHTKLAHVKHIQKGESVSYGATYTANQDTWIGTVPVGYADGWIRKLAGTE
VLVGGKRRKITGRICMDQFMVELKDKLPVGEPVVLIGKQGEDMIQVDEIAKRLETINYEI
TCSIGHRVPRVYIEDGKRVQVRNPLLQGGPSF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaatgccttttatagagacacatgggcagaaattaatttatcagcaattaag
cataatgtttcacatatgaaagatcatatcggtcaaagtgttcaactaatggctgtggtg
aaagccaatgcatatggacatggagatatagaagtggcaagtgctgctctcaaagcgggc
gcagacattttagccgtcgcctttttagatgaggccgtttctttaagaaataaaggcatc
aaagcaccaatacttgtactcggcgccgtaccgactgaatatgtcaaagtcgccgttcga
tacaatgtcatcatgaccgcttactccatcgattggctgaaagacgtcatcaacatgatg
gaaggccagatgggacaacctataagatttcatttgaaaatagacagcggaatgaaccga
ttaggtgtgaaaacgatagagcaagtgaacgaagtgaaaaagcttgtcgacgagcattct
tatttacagctggaaggcgtatttactcactttgcgacagcagatgaaaaggatgaggcc
tactttgatcgccaggttgacacctttcaaacactgcttgagccgcttcatacggacaag
cttctcattcattgtgccaacagtgcagcaggtttaaggtttaaagacgttttgtttaac
atggttcgcttcggcatcagtatgtacgggctgtcaccgtcagaagaaatcaaggatgaa
ttgcctttcaagcttgaagaagccatgtctcttcatacgaagcttgcccatgtgaagcac
attcaaaagggtgagagtgtcagctacggggcaacgtatacagccaatcaagatacgtgg
atcggcacggttccagtcggctatgcagatggatggattcggaagcttgcaggaacggaa
gtacttgttggcggaaagcgccggaagatcaccggaaggatttgtatggatcaattcatg
gttgaactgaaagacaagcttccagtgggcgagccggtcgttttaattggtaagcaaggc
gaagacatgatacaagtcgatgaaatcgccaaaaggcttgaaaccattaattatgaaatc
acgtgctcgattggtcaccgcgtcccgagagtgtatatagaggacggcaaaagagttcaa
gtgcggaatccactccttcaaggcggaccaagtttttga

DBGET integrated database retrieval system