KEGG   Bacillus pumilus SAFR-032: BPUM_1776Help
Entry
BPUM_1776         CDS       T00599                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00010  Glycolysis / Gluconeogenesis
bpu00053  Ascorbate and aldarate metabolism
bpu00071  Fatty acid degradation
bpu00280  Valine, leucine and isoleucine degradation
bpu00310  Lysine degradation
bpu00330  Arginine and proline metabolism
bpu00340  Histidine metabolism
bpu00380  Tryptophan metabolism
bpu00410  beta-Alanine metabolism
bpu00561  Glycerolipid metabolism
bpu00620  Pyruvate metabolism
bpu00625  Chloroalkane and chloroalkene degradation
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPUM_1776
   00053 Ascorbate and aldarate metabolism
    BPUM_1776
   00620 Pyruvate metabolism
    BPUM_1776
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BPUM_1776
   00561 Glycerolipid metabolism
    BPUM_1776
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPUM_1776
   00310 Lysine degradation
    BPUM_1776
   00330 Arginine and proline metabolism
    BPUM_1776
   00340 Histidine metabolism
    BPUM_1776
   00380 Tryptophan metabolism
    BPUM_1776
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPUM_1776
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPUM_1776
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BPUM_1776
Enzymes [BR:bpu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BPUM_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABV62448
UniProt: A8FDY1
LinkDB All DBs
Position
1819860..1821287
Genome map
AA seq 475 aa AA seqDB search
MRNQEKHFINGEWVASTGNETTEVINPATEEVIGTISLGTKEDLDKAVKAARSAFPSFSK
TSRNERVKMLENIVRGYEKRKDELVEVMTQELGAPLKVSEEVHYKMGYEHFSKAAEALKS
YTFTEDRGGHTIIKEAIGVSGLITPWNFPTNQTSLKIAGAIAAGSTVVLKPAEITPFAAM
ILAEIIDEAGVPKGVFNLVNGTGDVIGDGISSHPDIDFVSFTGSGAVGSKIMENAADNVK
KVALELGGKSPLIVLDDADVDVAAETAIQHIAMNTGQVCSAATRVLIPESMKDQFEKALL
NALPKFTVGDPREDHATGPLVSKKQWDTVQSYIEKGIEEGATLLAGGTGKPDGIDKGYFA
KHTIFTNVKNDMTIAQEEIFGPVMSVITYQNLDHALEIANDTVYGLAGYVVGKDEKTLKY
VAEHIRAGQITINNAETDYFAPFGGFKQSGIGREWGDFGIEEYLEVKAVMGLPTA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcaagagaaacattttattaacggagaatgggttgcatcaactggaaacgaa
acgacagaggtcatcaatcctgcaacagaagaggttattggcacgattagtttaggaaca
aaagaggatttagataaggcagtcaaagcagctcgttccgccttcccttctttctcaaaa
acatctcgaaatgaacgagtaaaaatgctggaaaacattgtgcgcggctatgaaaaacgc
aaagatgaacttgtagaagtgatgacacaagagctcggtgcaccgctaaaagtatcagaa
gaagttcattataaaatgggctatgaacatttttctaaagcggcggaagcacttaaatct
tatacatttaccgaagatcgcggcggacataccattataaaagaagcgattggcgtcagt
gggttgattacaccgtggaacttcccgacgaaccagacatcccttaaaatcgcaggagcc
attgcggcaggctcaacagttgtcttaaagccagcggaaattacaccatttgctgcaatg
attcttgcagaaattattgatgaagctggtgtaccgaaaggggttttcaacttagtaaac
ggaacgggagacgtgattggagacggcattagctcacatcctgatattgactttgtttca
tttactgggtcaggtgctgttggctctaaaattatggaaaacgcagcggacaatgtgaag
aaagtcgctcttgagcttggcgggaaatcccctcttatcgtcttagatgatgcagatgtg
gatgtggcagctgaaactgccattcagcatattgcgatgaatacaggtcaagtgtgttct
gcagctacacgtgtgctgattccagaatcaatgaaagatcagtttgaaaaagcgctactg
aacgccctaccgaagtttacagttggtgatccgagagaagatcatgctacaggtccgctt
gtatctaaaaaacaatgggataccgtgcaatcttatattgaaaaaggaatcgaagaaggt
gctacccttcttgctgggggaactggaaagccagacggaatcgataaaggatatttcgcc
aagcataccattttcaccaatgtgaaaaatgacatgaccattgcacaagaagaaatcttt
ggcccagtcatgagtgtcatcacgtatcagaatcttgatcatgctcttgagatcgccaat
gatacagtgtatggtcttgctgggtatgttgtgggaaaagatgaaaaaacattaaaatat
gtcgctgaacatattcgcgctggccaaatcaccattaacaatgccgaaacagattacttt
gccccatttggcggctttaagcaatcaggtatcggaagagaatggggagacttcggtatc
gaggaatatttagaagtgaaagctgtgatgggacttccaacggcgtaa

DBGET integrated database retrieval system